KEGG   Leuconostoc gelidum: C269_03655Help
Entry
C269_03655        CDS       T02322                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lge  Leuconostoc gelidum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:lge01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lge00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lge00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lge00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lge00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lge00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
767255..768223
Genome map
AA seq 322 aa AA seqDB search
MAKDKLIGVDLGGTTIKFAILTEAGEIQQKWSIKTNVFDDGVHIVPDIIESINHHLDLYQ
LDPKRVIGIGMGTPGTVNRTTGTVTGAYNLNWKTEQSVKADIESGTGFSLTLDNDANAAA
LGEAWRGAGNNDDEVSFITLGTGVGGGLVSNGQLIHGTAGAGGEIGHVVVEPNGYLCTCG
NKGCLEQYTSATGVVHLAQDFSEEYVGSSKLKQLIADGDEVTSKIVFDLAKDGDFLANKV
IDKVAYYLGYATAAMSNILNPSAVVIGGGVAAAGEFLRARVEKNWQTFAFPTVRSTTRVK
LAELGNDAGVIGAASLARVNTN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagataaattaatcggtgttgaccttggtggcacaacaattaagtttgctatt
ttgactgaagctggcgaaattcaacaaaaatggtcaattaaaacgaatgtttttgatgat
ggtgtacatattgtaccagatattattgaatcaattaatcatcaccttgacttatatcaa
ttagatccaaaacgtgtgattggtattggtatgggcacacctgggacggtaaaccggaca
actggcactgtgactggggcttataacttaaattggaagacagaacaaagtgttaaagca
gacattgaatctggtactgggttttcgttgacactggacaatgacgctaacgctgcagca
cttggtgaggcttggagaggtgctggtaataatgatgacgaagtatcatttatcacactt
ggtaccggtgttggtgggggcttagtgtccaatggccaactgattcatggaactgccggt
gcagggggtgaaattgggcatgttgttgttgagcccaatggttacttgtgtacttgtggg
aacaaaggttgcttggaacaatatacttcggcgactggtgttgtacacttagcacaagat
ttttctgaagagtatgttggttcatcaaagctaaaacaattaattgccgatggggatgaa
gtcacttcaaaaattgtgtttgatttagcaaaagatggtgattttttggctaataaggtc
attgataaagtggcatattacttaggctatgctacagcagctatgtctaacatattaaat
ccatcagccgttgttatcggtggtggtgtggccgcagcgggtgagtttttacgtgcccgt
gtagaaaaaaattggcaaacatttgcatttccaacagtcagaagtacaacacgtgttaaa
ttagccgaattaggtaatgatgctggcgtcattggcgcagcatcattggcacgtgttaac
actaattaa

DBGET integrated database retrieval system