KEGG   Leuconostoc gelidum: C269_04445Help
Entry
C269_04445        CDS       T02322                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lge  Leuconostoc gelidum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lge01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lge00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
923116..923334
Genome map
AA seq 72 aa AA seqDB search
MKNFSINFNNTQRLRDMMPKDILVMSDLSIKTHADTVLLEILQVDDISIDDIFMKRKDKI
DMIKSGWDNTCV
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatttttcaattaattttaacaatacacaacgtttacgtgacatgatgcctaaa
gatatacttgtcatgtctgatttgagcatcaaaacacatgctgacacagtattgctggag
atcttacaagtagacgatatttcaattgatgatatctttatgaagcgtaaagataaaata
gatatgattaaaagtggatgggataatacgtgcgtatga

DBGET integrated database retrieval system