KEGG   Leuconostoc gelidum: C269_04445Help
Entry
C269_04445        CDS       T02322                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lge  Leuconostoc gelidum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C269_04445
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C269_04445
Enzymes [BR:lge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     C269_04445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
923116..923334
Genome map
AA seq 72 aa AA seqDB search
MKNFSINFNNTQRLRDMMPKDILVMSDLSIKTHADTVLLEILQVDDISIDDIFMKRKDKI
DMIKSGWDNTCV
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatttttcaattaattttaacaatacacaacgtttacgtgacatgatgcctaaa
gatatacttgtcatgtctgatttgagcatcaaaacacatgctgacacagtattgctggag
atcttacaagtagacgatatttcaattgatgatatctttatgaagcgtaaagataaaata
gatatgattaaaagtggatgggataatacgtgcgtatga

DBGET integrated database retrieval system