KEGG   Leuconostoc gelidum: C269_05840Help
Entry
C269_05840        CDS       T02322                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lge  Leuconostoc gelidum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lge00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    C269_05840
Enzymes [BR:lge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     C269_05840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1204303..1206687)
Genome map
AA seq 794 aa AA seqDB search
MAYQEQQLEKITGTLQNVIFASSDSYFKILSILIEESTLESWQEPEIIATGTFADVQEGS
VYAFYGTVVRHPKYGQQLKVMRYENELPPDEEGLIKYFVSGQFSGIGQKTAEKIVDHLGL
NAVNLILDDVHVLDGIIKEATAKKLVQSLQLNLGLERLFQVGNQFGIGADIAGRLYDQYG
SEAQDILIQDPYRLVFEFDGISFKTADQIGQKSGIDHLDERRLQAAVYAAITTVSFQYGH
TYLTRQQLLQSTAQLLRDEELKGALEQAITKLLATHILVADNDKLYTTALYDAETQVAHD
LKRLLQAKQPFEMSVADIDAAFITPGQLELDRTQIAAVKAGLNAQVFLLTGGPGTGKTTI
VRSIVATWQKILQKRAKYSDQAQDFLKMYSVKMASPTGRAAKRMTEVTGYDATTIHRLLG
IADLGEPEFTADNPISGGLLIIDEASMLDIELTAKLLAAVPNGMKLIIVGDSDQLPSVGP
GNVLADLVASEKMTHVELDTIYRQGRGSSITKLAQHIKNGQLPEDFMQNQPDRSTFMVSH
DQTDMAIKQVVQAAIKKGYTQDDLQILTPIYKTTAGVNALNTMAQELFNPIKPAQKSLQF
GTTIFRKGDKILQLENDSERDVYNGDMGKIIAVQYKNDKSNDDHEDRLLVDFDGKELSYP
KKNLNQLSLAYATTVHKAQGNEFKLVIVALTTRFGLMLNRNLLYTGITRAKEALILVGEY
EAFSRAAQTAVAYRATFLTERLKDEVVIQQKNSHDKKRERAILKNILTFELIQSDTIEPL
IGLNGITPYDFMPN
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaagaacaacaactcgaaaaaattactggtacgttacaaaatgttatattt
gcatcgtctgattcctactttaaaatcttgtctattctgattgaagaatcaacgcttgaa
agttggcaagagcctgaaattattgcaactggcacatttgccgatgtgcaagagggcagt
gtatacgctttttatggtacggttgtgcggcacccaaaatatggacagcaactgaaagta
atgcgctatgaaaatgaattacctcccgatgaagaaggactcatcaaatattttgtgagt
gggcaattttcaggtattggtcaaaaaacagctgaaaaaattgttgatcatttgggttta
aatgctgttaatttaattttggatgatgttcatgtattggatggtatcatcaaggaagct
actgcaaaaaaacttgtccaaagtttgcaattgaatttgggcttagaacgcttatttcaa
gttggcaaccaatttggcattggtgcagatattgccggacgattgtatgatcaatatggt
agtgaggcacaagatattttgattcaagatccttatcgtttggtgtttgagtttgatggt
atatcgtttaaaacagcagatcagatcggacaaaaatctggcattgatcatttggatgaa
agacggttacaggcagcagtttatgctgcaataacgactgttagctttcaatatggacat
acttatttaacgcgacaacagctactgcagtcaacggcacaattattgcgtgatgaggaa
ctaaagggtgcattagaacaggcaattaccaaactattggcaacccatattttagtggct
gacaatgataaattatatacaacagctttgtatgatgcagaaacacaagtagcccatgac
ttgaaacgtttattgcaggcaaaacaaccatttgagatgtcagttgcagatatcgatgcg
gcttttatcacgccgggccaattagaactcgataggacacaaattgcggcagttaaagca
ggattgaacgcacaagtatttctgcttactggtgggcctggaacaggaaagacaaccatc
gttcgttcaattgttgcaacatggcaaaaaattcttcaaaagcgtgctaaatactctgat
caggcacaggattttttgaaaatgtattcagttaaaatggcatcgccaactggtcgagca
gccaaacgtatgactgaagtaactggatatgatgcaacaacaatacaccgtttacttggt
attgctgatttaggtgaacccgagtttacggctgataatccgatttcaggcggtctgctc
attattgatgaggcatcgatgttggatattgaattgacagctaaactacttgccgcagtg
ccaaatggtatgaaactaatcattgttggtgattcagatcagttgccttcagttggaccc
ggtaatgtattagcggatctggtcgcgagtgaaaaaatgactcatgtagagcttgataca
atttatcgacaaggtagaggaagcagtattaccaagttggcacaacatatcaaaaatggt
cagttaccggaagattttatgcaaaatcaacctgatagatcaacgtttatggtgtcacat
gatcaaaccgatatggcaattaaacaggtggtccaagctgctataaaaaagggatatact
caggatgatttacaaattctaacgccgatttataaaacgactgctggtgttaatgcgttg
aatacaatggcgcaagaattatttaatccaatcaaaccagctcaaaaatctttgcaattt
gggacaacaatcttccgtaaaggagataaaattttgcaattagaaaatgatagtgagcgt
gacgtgtataatggggatatgggtaaaattattgctgtgcaatataaaaatgataaaagt
aatgatgatcatgaggatcgattactggttgattttgacggaaaggaattatcttatcct
aagaaaaatttaaatcaattatcacttgcttatgcaaccactgtacataaggcacaaggc
aatgagtttaaacttgtaattgttgccttaacaacccgatttggtttgatgctcaatcga
aacttactttacacaggtattacgcgtgcaaaagaagctttaattttggttggtgaatat
gaagcatttagtcgtgctgcgcaaactgcagtcgcatatcgagcaacttttctaacagag
cgcttgaaagatgaagtagtcattcaacaaaaaaatagtcatgacaaaaaaagagagcgc
gccattttaaaaaatatattaacatttgaattgattcagtcagataccattgagccatta
attggattaaatggtatcacaccatatgattttatgccaaattaa

DBGET integrated database retrieval system