KEGG   Leuconostoc gelidum: C269_06885Help
Entry
C269_06885        CDS       T02322                                 

Definition
pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lge  Leuconostoc gelidum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lge01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lge00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lge00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lge00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1437304..1438611)
Genome map
AA seq 435 aa AA seqDB search
MTEIFKMPDIGEGMAEGDITSWFIKVGDVVAMDDPVAEVQNDKLIQEILSPYAGKVTKLF
VEAGTTVEVGDSLIEFDGDGSGEATSGQEPDKVDKKQVSEVPLKNPTVPTETVTSPQTES
IVHVANGHVLAMPSVRHLAYEKGIDLTKIMPSGRHGHVTLSDVEKFQDVGETTPEINAQQ
VVKTTEALSTNNSSSLAAPEPLREGRQPLTAVRRAIAKAMTTQNANIPSVTNFDSVEVSK
LVAHRQIFKTQAANDGIHLTYLAYVVKALAATAKKFPELNASLDMATQEVIYHDDVNMGV
AVSTASGLYVPVIGHADQKSILTIASEISELAEAVRTGTIRPQQMQGGTITISNLGSARG
TWFTPIINGKEVAILGLGSILKEPIVNENGDLTIGQNMKLSLSYDHRLIDGMLGQSAMNY
LKQLLTDPAYMLMEV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaaaatgcctgatattggtgaaggcatggctgagggagatattaca
tcatggttcattaaggtcggagatgtagtggctatggatgaccctgttgctgaagttcaa
aatgataaattaattcaagaaattttatcaccttacgctggtaaagtgacgaaattattt
gtcgaagcaggtacaactgttgaagtaggtgattcattaattgaatttgatggcgatggc
agtggtgaagctacaagtggtcaagaaccggataaggtggataagaagcaagtttctgaa
gtaccattaaaaaatcctactgtaccaactgaaacagtgacgagtccgcaaacagaaagc
atcgtacacgttgctaatggtcatgttttagctatgccttcagttcgtcatttggcttat
gaaaaaggaattgatcttacaaaaattatgcctagtggtcgtcatggacacgttactttg
tctgatgttgaaaaattccaagatgttggtgaaacaacaccggagattaatgcacaacaa
gtagttaaaacaacagaagcgcttagcacaaataatagttcttctctggctgcacctgaa
ccattacgagagggtcgtcaaccattaacagcagtacgtagggcaattgctaaagcaatg
actacacaaaatgccaatattccatcggttactaattttgattcagttgaggttagtaag
ttagtggctcatcgtcaaatatttaaaacgcaagccgctaatgatggcattcacttgaca
tatttagcatatgttgtgaaagcattagctgccacagcaaaaaaattcccagaattgaat
gctagtttagatatggcaacacaagaagtcatctaccatgatgatgttaatatgggtgta
gcagttagcacagcatcaggattgtatgtaccagtgattggacatgcggatcaaaagtca
attttgaccattgcttcagagatttctgaacttgctgaagcagttcgtactggaaccatt
cgccctcagcaaatgcaaggtgggacgattacgatttctaatttaggatcagcacggggc
acatggttcaccccaattattaatggtaaagaagtcgctatcttggggctgggttcaatt
ttgaaagaacctattgtcaatgaaaatggcgatcttacaattggtcaaaatatgaagcta
tcactgagctatgatcatcgtctaattgatggcatgcttgggcaatcagctatgaactat
ttgaagcaattattgactgatccggcttatatgttaatggaggtgtaa

DBGET integrated database retrieval system