KEGG   Leuconostoc gelidum: C269_07945Help
Entry
C269_07945        CDS       T02322                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lge  Leuconostoc gelidum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    C269_07945
Enzymes [BR:lge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     C269_07945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1656085..1656669)
Genome map
AA seq 194 aa AA seqDB search
MKDNKVFVITGATGVGKTTIARYLQDNYRMPRVITHTTRAPRDREVNGISYYFEDDLTFE
TKHYLERVKYAGSQYGSSYEALEFAWQKSPYITIVLDTAGAITYARELGKQAVIIFVTVT
SPKVLVERVQVRGDDPTAVKQRVASPEFLRDVLLPTELKNIAYELANDDWAKTKVRLDLL
VNDIMNGRSLPQKN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacaataaagtatttgtaattacgggtgcaactggtgtcggtaaaacaacaatt
gcgcgatatttacaagataattatcgtatgccacgtgttattacacacacaacaagagca
ccgcgggatagagaagtcaatgggatatcgtactatttcgaagatgatctcacatttgaa
acaaaacactatttagagcgagtgaaatacgcagggtcacaatatggttcatcatatgag
gcacttgaatttgcctggcaaaaaagtccatatattacaattgtactggacactgctggt
gcaatcacctatgctcgtgaacttgggaaacaggcagtgattatttttgttacggtaacc
agccctaaagtattagttgagcgtgttcaagtgcgtggcgatgatccaactgctgttaag
cagcgtgtcgcttcaccagaatttttgcgtgatgtcttgttaccgactgaattaaaaaat
atagcttacgaattggctaacgatgattgggcgaagacaaaggtcaggcttgacttactt
gtaaatgacatcatgaacgggcgcagtttgcctcaaaaaaattag

DBGET integrated database retrieval system