KEGG   Leuconostoc gelidum JB7: C269_08030Help
Entry
C269_08030        CDS       T02322                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lge  Leuconostoc gelidum JB7
Pathway
lge00010  Glycolysis / Gluconeogenesis
lge00051  Fructose and mannose metabolism
lge00562  Inositol phosphate metabolism
lge01100  Metabolic pathways
lge01110  Biosynthesis of secondary metabolites
lge01120  Microbial metabolism in diverse environments
lge01130  Biosynthesis of antibiotics
lge01200  Carbon metabolism
lge01230  Biosynthesis of amino acids
Module
lge_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C269_08030 (tpiA)
   00051 Fructose and mannose metabolism
    C269_08030 (tpiA)
   00562 Inositol phosphate metabolism
    C269_08030 (tpiA)
Enzymes [BR:lge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     C269_08030 (tpiA)
Exosome [BR:lge04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   C269_08030 (tpiA)
  Exosomal proteins of bladder cancer cells
   C269_08030 (tpiA)
  Exosomal proteins of melanoma cells
   C269_08030 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFS41041
UniProt: J9YI44
Position
complement(1678601..1679413)
Genome map
AA seq 270 aa AA seqDB search
MTKTHKAQRVPFVVANWKINKLQADVVDFLAQVNGKVPDKRVVETGIAAQDLFLSDMVRA
TADSPIHVVAENVHWEDNGAYTGETSPRALKDIGAKYVLIGHFERRKFFNETDSTVNLKV
TAALRNGLRPIIDVDEDMSTYAQFMDAEPSVAQVAAALAGVSVDQIRNVTIAYEPTWAIG
SGEAASADQAQKAAHLIRQTLAKLYSPVIAEQVRILYGGSVTPNNAREIMLQKDIDGVLV
GTAALDPTQFLQLVEIVRDPNVPEFDVDHI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaactcataaggcgcaacgggtgccattcgtagtcgctaattggaaaattaac
aagttacaagcagatgttgttgattttttggcacaggttaatggcaaagtgccagacaaa
cgagtcgttgagacaggtattgcagcacaagatttgtttttgtcagatatggtgcgtgcg
acggcagattcaccaattcatgttgtggctgaaaacgttcattgggaagataatggcgct
tatacaggtgaaacatcacctagggctttaaaggatattggcgcaaaatatgtattaatc
ggtcacttcgaacggcgaaagttttttaatgaaacagattcaacagttaatttgaaagta
acagctgccttacggaacggtttacgtccaattattgatgttgacgaagatatgagcacc
tatgcacagtttatggatgctgaaccttctgtcgcccaagtagctgcagcattagctggc
gtttccgtagatcaaattagaaatgttactattgcatatgagcccacatgggcaattggt
tctggtgaagcggctagtgctgatcaagcacaaaaagcagctcatcttatccgtcaaaca
ttggctaagctatattcaccagttattgcggagcaagttcgaattctgtatggtggctca
gtcacacccaacaatgcgcgtgaaattatgctgcaaaaggatatagacggtgttcttgtt
ggaacagcagcgttagatccaacacaatttctgcaattagttgaaattgtgcgcgatcca
aacgtaccagaattcgatgtagatcacatttaa

DBGET integrated database retrieval system