KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_116587Help
Entry
LOTGIDRAFT_116587 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
lgi  Lottia gigantea (owl limpet)
Brite
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     LOTGIDRAFT_116587
Peptidases [BR:lgi01002]
 Serine Peptidases
  Family S33
   LOTGIDRAFT_116587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 285 aa AA seqDB search
GMERKFIDVNGVRLCYGEKGQASGSRPTILLIHGFSADHYMWAPVAQRIPGDYHVIAVDQ
PGHGGSDDPHETESICYYGQVKKLYEFIQHKKLDMEKKLHIVGLSMGGTIGGLFAAEYPH
LIHKVTICCPSMQTPSASIFVQKLKDSVDEKGEDEGILACGLLPQTPSELQNMLNLSHYY
PQTLPQQILQGAADMRKKRNVFFLKLFRSIAEKSSTLVDNIHRIQSPVQIIWGKDDSIID
VSGLEVLKEKLTDCKSVEVIDSCGHVITIDQPTVFTKHLLEFHHI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ggaatggagagaaagtttatagatgttaatggtgtaagattatgttatggtgaaaagggc
caggcgtctggatctagaccaactatattattaatacatggtttctcagcagatcattat
atgtgggctccagttgctcagaggataccaggtgattatcatgtgatagcagtggatcag
cctggacatggtggaagtgatgatcctcatgaaacagaatctatctgttattatggtcag
gttaaaaaactctatgagtttatacagcataagaaactagacatggagaagaaactacat
atagttgggttatctatgggaggaactattggtggtttatttgctgcagaatatccacat
ctaatacataaagtaacaatctgctgtccatcaatgcagacgccatcagccagtattttt
gttcagaaattaaaagattcagtagatgagaagggagaagatgaaggaatattagcttgt
ggtttattacctcaaacaccatcagaactacaaaatatgttaaacttaagtcattattat
ccacaaacattacctcaacagattttacaaggagcagcagacatgaggaaaaagagaaat
gtattttttttaaaactatttagaagtattgctgagaaatcctcaacattagtagataat
atacatcgtattcagtcaccagtacaaattatctggggtaaagatgacagtattatagat
gtatcaggtttagaagtattaaaagaaaagttaacagactgtaagagtgtagaagtgata
gattcatgtggacatgtgattactatagatcagcctacagtatttactaaacatttatta
gaatttcatcatatttaa

DBGET integrated database retrieval system