KEGG   Lactobacillus ginsenosidimutans: ABM34_11670Help
Entry
ABM34_11670       CDS       T03990                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lgn  Lactobacillus ginsenosidimutans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lgn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABM34_11670
   00630 Glyoxylate and dicarboxylate metabolism
    ABM34_11670
   00640 Propanoate metabolism
    ABM34_11670
   00650 Butanoate metabolism
    ABM34_11670
  Lipid metabolism
   00071 Fatty acid degradation
    ABM34_11670
   00072 Synthesis and degradation of ketone bodies
    ABM34_11670
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABM34_11670
   00310 Lysine degradation
    ABM34_11670
   00380 Tryptophan metabolism
    ABM34_11670
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABM34_11670
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABM34_11670
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABM34_11670
Enzymes [BR:lgn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABM34_11670
Exosome [BR:lgn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABM34_11670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2339647..2340801
Genome map
AA seq 384 aa AA seqDB search
MDSVVIIDAKRTAIGKFRGQFANVSSVELGTELVKQLLTNNKINPEDVDQFIFGNVYQSG
MGQNVARQIGINVGGSAKSTAMTVNQVCGSGMKAVHDATNALLLEDADIIVCGGVESMSN
APFYSKRVGKLEVSDEQGDTLFRDGLVDAFGNYPMGITAENVAKRYNVTRQMQDEFSLQS
QKKAFAATDKIADEILPIEVDGKQVVTDQSIRGESTLETMSNLKPAFEENGTVTAGNSSP
LNDGAAAMILMRKKTAEKLGLSYIAELKGYVEAGIDPSIMGYAPYYAINKYYDKYNITQD
QIDYFEINEAFAAQSVAVARDLKIPDDKLNVFGGAIAIGHPLGATGARLIVSLINILQKE
NKKSGIASLCIGGGMGMALGLELS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggattcagtcgttattatagatgccaagagaactgctattggcaaattccgcggtcag
ttcgcaaatgtctcatcagtcgaactcggcacagaactagtaaagcagttattgactaat
aacaaaatcaatccagaagatgtcgatcaattcatttttggaaacgtttatcaatccgga
atgggacaaaatgtcgccagacaaattggtataaacgttggtggtagtgcaaagtcaacc
gccatgacagtcaatcaagtatgtggttcaggtatgaaagctgtgcacgacgcaacaaat
gccttactgctagaagatgccgatatcatcgtttgtggtggtgttgaaagcatgtcaaac
gcacctttttactcaaaacgtgtcggcaagttagaagtttccgatgaacaaggtgataca
ttatttcgagacggattagttgatgcctttggaaattatccaatgggaatcaccgccgaa
aatgttgccaaacgatacaacgtaactcgccaaatgcaagacgagttttctttgcagtct
cagaagaaagccttcgcagcgactgacaaaattgccgatgagatcttgccaattgaagtt
gatggtaagcaagttgtcaccgaccaatcaattcgtggcgaatcaacactcgaaacaatg
tcaaatctcaaaccagcttttgaagaaaacggaacagttaccgccggcaattcctcacct
ctaaatgacggtgcagcagcgatgattttaatgcgtaagaagactgctgaaaaattaggc
ttgtcgtatattgccgaattgaaaggctacgtcgaagctggtattgatccaagtatcatg
ggttatgctccatattatgccatcaacaaatattatgataagtacaatatcactcaagac
caaattgattatttcgaaatcaatgaagcttttgccgcccagtcagtagcagtggctcgt
gacttgaagatacctgatgataagttgaatgtgtttggtggagccattgcaatcggtcat
ccattaggtgcaacaggcgcacgtcttatagtttcactaataaacattttgcaaaaagaa
aataagaaatccggtattgcttcactctgcattggtggaggaatggggatggcgttagga
ctcgaattatcatga

DBGET integrated database retrieval system