KEGG   Lactococcus garvieae ATCC 49156: LCGT_0030Help
Entry
LCGT_0030         CDS       T01618                                 

Definition
dihydrolipoamide dehydrogenase E2 subunit
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lgr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lgr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lgr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lgr00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(35745..37328)
Genome map
AA seq 527 aa AA seqDB search
MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPVAEVQNDKLMQEILSPYSGTVTKLF
VEAGTTVEVGAPLIEYDGDGSSEADTADAAPAAASEAPSGDAQIFTMPDIGEGMHEGDIA
NWLVKVGDDVKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVEAGTTVEVGAPLIEYNGNG
STAAATPAPKAAPTADTAPAAAPKAEGGATTRTTADGRVLAMPSVRHYAREHGIDLTQVQ
STGRHGHTTLADVKAFASGAAAPKAAAPTEAKPAPKADAAKPAAPKPAPAPVQAAEGDRR
EPMTPTRKAISNAMSTQNANIPAVTNFDQVEVSKLVAHRKEYKEIAAKQDVKLTYLAYVT
KALAATAKKFPEINASIDGTDIVYHNDVNIGIAVNAPSGLYVPVIKNADKKSIFTIAKEI
SELAEAVRTGSIKPDQMRGSTITISNIGSARGTWFTPIINGSDVMILGLGSIVKEPIVNA
EGELAVGQNMKLSVSYDHRLIDGMLGQGSLNYLKSLLADPAYMLMEV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatttttaaaatgcctgatatcggcgaaggcatgcacgaaggcgatatcgcc
aactggcttgtaaaagtcggagatgtcgttaaagaagacgatcccgtagccgaagtacaa
aacgacaaattgatgcaagaaattttgtctccttactctggtactgtaacaaaacttttc
gttgaagctggaacaactgttgaagttggcgctccacttatcgaatatgatggagatggt
tcaagcgaagctgatactgcagatgcggcacccgctgctgcttctgaagctccttcaggg
gatgctcaaatcttcaccatgcctgatatcggtgaagggatgcacgaaggcgatatcgcc
aactggcttgtaaaagttggagacgacgtcaaagaagacgaccctgttgctgaagtacaa
aacgacaaattgatgcaagaaatcttgtctccttactctggtaaagttacaaaactcttt
gttgaagctggaacaactgttgaagttggcgctccacttatcgaatacaatggtaatggt
tctacagctgctgctacaccagctcctaaagccgctccaactgctgatactgctccggca
gctgctcctaaagctgaaggcggtgctacaacacgtacgactgctgatggacgtgtactt
gcgatgccatctgtacgtcactatgcgcgtgaacacggtattgatttaactcaagttcaa
tctacaggtcgtcacggccacacaacattggcagatgttaaagcctttgcttctggcgca
gctgctcctaaagctgcagctccaactgaggctaagccagctccgaaagctgatgcagct
aaacctgccgctcctaaaccagctccagctcctgtacaagcagctgaaggcgatcgtcgt
gaaccaatgacgccaacacgtaaagctatctctaacgcgatgagcacacaaaatgcaaat
attccagcggttactaactttgaccaagtggaagtctctaaacttgttgctcaccgtaaa
gaatacaaagaaattgcggctaaacaagacgttaaacttacttaccttgcttacgtaact
aaagccttagctgcgacagctaagaaattcccagaaattaacgcttctatcgacggtaca
gatattgtttaccacaatgatgtaaacatcggtatcgccgtaaatgcgccaagcggactt
tacgtacctgtgattaaaaatgcagataagaaatcaatctttacaattgctaaagaaatt
tctgaactcgctgaagctgtacgtactggttctatcaaacccgaccaaatgcgtggttca
acaatcacaatctcaaatattggttctgcccgtggtacttggttcacaccaatcatcaat
ggctctgacgttatgatcctcggccttggttcaatcgttaaagaaccaatcgttaatgct
gaaggtgaattagctgttggtcaaaacatgaagctttctgtaagctatgaccaccgtctt
atcgatggtatgctcggacaaggttcattgaactatcttaagagtcttttggctgatcca
gcttacatgctcatggaagtttaa

DBGET integrated database retrieval system