KEGG   Lactococcus garvieae ATCC 49156: LCGT_0110Help
Entry
LCGT_0110         CDS       T01618                                 

Definition
dTDP-4-keto-6-deoxy-D-glucose 3,5-epimerase RmlC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LCGT_0110
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LCGT_0110
Enzymes [BR:lgr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LCGT_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
117411..118007
Genome map
AA seq 198 aa AA seqDB search
MTDNFFGKELAARKIEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPEKFFAEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGRVLGSWVDLREGESFGHVYQTVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPTLGIEWEDLANAEVSEAD
KNHPLLADVKPLTADLLG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacggataacttttttggaaaagaacttgcagcgcgtaaaatcgaggctattccaggt
atgttagaatttgatattcctgttcatggtgataatcgcggctggtttaaagaaaacttt
caaaaagaaaaaatgcttcccctcggtttcccagagaaattcttcgcagaaggaaagtta
caaaataatgtttctttctcacgtaaaaatgttttgcgcggtttacacgcggaaccatgg
gacaaatacatttctgtagcagatggtggacgtgttctaggttcttgggtagatctccgt
gaaggggagagttttggccatgtttatcaaacagtgattgatgccagcaagggtattttt
gtgccacgtggtgttgccaatggtttccaagttttaagtgataccgtttcttactcttac
ttagtgaatgattattgggctttggaacttaaaccaaaatatgcctttgtcaattatgca
gatccaactttaggtatcgaatgggaagaccttgcgaatgctgaagtgagtgaagcagac
aaaaatcacccattgcttgcagatgtaaagcccttgaccgcagatttactcggctaa

DBGET integrated database retrieval system