KEGG   Lactococcus garvieae ATCC 49156: LCGT_0193Help
Entry
LCGT_0193         CDS       T01618                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lgr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187103..188542
Genome map
AA seq 479 aa AA seqDB search
MSNNIRVRYAPSPTGLLHIGNARTALFNYLFARHYDGDFIIRIEDTDRERHVEDGERSQL
ENLRWLGIDWDESPETHENYRQSERLELYQKYIDQLLSEGKAYYSYKTPEELEADHEAQE
AAGVAPHYVNEYAGMSEAEKEAYIAERKAAGITPVVRISVNETAIYKWTDMVKGDIEFEG
GNIGGDWVIQKRDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMIYEALGWEAPV
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGFMADAIFNFIALLGWNPGGEQEKFSP
EELVKLFDEKRLSKSPAAFDQKKLEWMDNEYIKHAEFEPVFELTKPFLEEAGRFDARAEE
LVKLYKPQMKYAEEILELTDLFFGEFPELTDEARQMMALETSPLAVGAFREKLATLEDFT
AENIFPLFKETQKETGVKGKNLWMPIRIAASGSMHGPELPETIALLGKEKVLEHMAQFL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataacattcgtgtgcgctatgcgccatcaccaactgggcttttacatatcggt
aatgcccgtactgcactttttaactatctttttgcgcgtcattatgacggagatttcatc
attcgtatcgaagatacagaccgcgaacgtcatgtggaagatggagaacgttctcaactt
gaaaacttacgttggttggggattgactgggatgaaagcccagaaacacatgaaaactac
cgccaatctgaacgtttggaactttaccaaaaatatattgaccaacttttgagtgaaggt
aaggcttattactcttataaaacgccagaagagcttgaagctgatcatgaagcacaagaa
gcagcaggcgttgcaccgcattatgttaatgagtatgcgggaatgtcagaagctgagaaa
gaagcttatatcgctgaacgtaaagcagcaggcattacaccggttgttcgtatttctgta
aatgaaacagccatttacaaatggacagatatggttaaaggtgatatcgaatttgaaggt
gggaacatcggtggcgattgggttattcaaaaacgcgacggttacccaacttataacttt
gctgtagtagtggacgaccatgatatgcaaatttcacacgttattcgtggggacgatcac
attgcgaatacaccgaaacagttgatgatttatgaagctttaggctgggaagcacctgtc
tttgggcatatgactttaattattaactctgaaacagggaaaaagttgtctaaacgtgac
accaatacgcttcaatttatcgaagactaccgtaaaaaaggtttcatggcagatgctatt
ttcaactttatcgccctcttaggttggaacccaggtggtgaacaagaaaaattcagccca
gaagaacttgtaaaactttttgatgaaaaacgtttgagtaaatctccagcagcctttgac
caaaagaaactggaatggatggacaacgaatacatcaaacatgcagagtttgaacctgtc
ttcgaattgacaaagcctttccttgaagaagccggtcgttttgatgcgcgtgctgaagaa
ttggtaaaactttacaaaccacaaatgaaatatgctgaggaaattctggagttaacagac
ctcttctttggtgaattcccagaactcacagatgaagcgcgtcaaatgatggctttggaa
acttcaccccttgctgtcggtgcgtttcgtgaaaaactggcaaccttagaagattttact
gctgagaatatcttcccgcttttcaaagaaacacaaaaagaaacaggggttaaaggaaaa
aatctttggatgccaattcgtattgctgcttctggtagcatgcacggtccagaattacct
gaaacaattgctcttttaggcaaagaaaaagttcttgaacacatggcacagttcttataa

DBGET integrated database retrieval system