KEGG   Lactococcus garvieae ATCC 49156: LCGT_0193Help
Entry
LCGT_0193         CDS       T01618                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LCGT_0193
Enzymes [BR:lgr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LCGT_0193
Amino acid related enzymes [BR:lgr01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LCGT_0193
Transfer RNA biogenesis [BR:lgr03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LCGT_0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187103..188542
Genome map
AA seq 479 aa AA seqDB search
MSNNIRVRYAPSPTGLLHIGNARTALFNYLFARHYDGDFIIRIEDTDRERHVEDGERSQL
ENLRWLGIDWDESPETHENYRQSERLELYQKYIDQLLSEGKAYYSYKTPEELEADHEAQE
AAGVAPHYVNEYAGMSEAEKEAYIAERKAAGITPVVRISVNETAIYKWTDMVKGDIEFEG
GNIGGDWVIQKRDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMIYEALGWEAPV
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGFMADAIFNFIALLGWNPGGEQEKFSP
EELVKLFDEKRLSKSPAAFDQKKLEWMDNEYIKHAEFEPVFELTKPFLEEAGRFDARAEE
LVKLYKPQMKYAEEILELTDLFFGEFPELTDEARQMMALETSPLAVGAFREKLATLEDFT
AENIFPLFKETQKETGVKGKNLWMPIRIAASGSMHGPELPETIALLGKEKVLEHMAQFL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataacattcgtgtgcgctatgcgccatcaccaactgggcttttacatatcggt
aatgcccgtactgcactttttaactatctttttgcgcgtcattatgacggagatttcatc
attcgtatcgaagatacagaccgcgaacgtcatgtggaagatggagaacgttctcaactt
gaaaacttacgttggttggggattgactgggatgaaagcccagaaacacatgaaaactac
cgccaatctgaacgtttggaactttaccaaaaatatattgaccaacttttgagtgaaggt
aaggcttattactcttataaaacgccagaagagcttgaagctgatcatgaagcacaagaa
gcagcaggcgttgcaccgcattatgttaatgagtatgcgggaatgtcagaagctgagaaa
gaagcttatatcgctgaacgtaaagcagcaggcattacaccggttgttcgtatttctgta
aatgaaacagccatttacaaatggacagatatggttaaaggtgatatcgaatttgaaggt
gggaacatcggtggcgattgggttattcaaaaacgcgacggttacccaacttataacttt
gctgtagtagtggacgaccatgatatgcaaatttcacacgttattcgtggggacgatcac
attgcgaatacaccgaaacagttgatgatttatgaagctttaggctgggaagcacctgtc
tttgggcatatgactttaattattaactctgaaacagggaaaaagttgtctaaacgtgac
accaatacgcttcaatttatcgaagactaccgtaaaaaaggtttcatggcagatgctatt
ttcaactttatcgccctcttaggttggaacccaggtggtgaacaagaaaaattcagccca
gaagaacttgtaaaactttttgatgaaaaacgtttgagtaaatctccagcagcctttgac
caaaagaaactggaatggatggacaacgaatacatcaaacatgcagagtttgaacctgtc
ttcgaattgacaaagcctttccttgaagaagccggtcgttttgatgcgcgtgctgaagaa
ttggtaaaactttacaaaccacaaatgaaatatgctgaggaaattctggagttaacagac
ctcttctttggtgaattcccagaactcacagatgaagcgcgtcaaatgatggctttggaa
acttcaccccttgctgtcggtgcgtttcgtgaaaaactggcaaccttagaagattttact
gctgagaatatcttcccgcttttcaaagaaacacaaaaagaaacaggggttaaaggaaaa
aatctttggatgccaattcgtattgctgcttctggtagcatgcacggtccagaattacct
gaaacaattgctcttttaggcaaagaaaaagttcttgaacacatggcacagttcttataa

DBGET integrated database retrieval system