KEGG   Lactococcus garvieae ATCC 49156: LCGT_0207Help
Entry
LCGT_0207         CDS       T01618                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00010  Glycolysis / Gluconeogenesis
lgr00260  Glycine, serine and threonine metabolism
lgr00680  Methane metabolism
lgr01100  Metabolic pathways
lgr01110  Biosynthesis of secondary metabolites
lgr01120  Microbial metabolism in diverse environments
lgr01130  Biosynthesis of antibiotics
lgr01200  Carbon metabolism
lgr01230  Biosynthesis of amino acids
Module
lgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lgr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_0207
  Energy metabolism
   00680 Methane metabolism
    LCGT_0207
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCGT_0207
Enzymes [BR:lgr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCGT_0207
Membrane trafficking [BR:lgr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LCGT_0207
Exosome [BR:lgr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCGT_0207
  Exosomal proteins of melanoma cells
   LCGT_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAK57720
Position
205965..206666
Genome map
AA seq 233 aa AA seqDB search
MVKLVFARHGESEWNLANLFTGWADVDLSENGTQQAIDAGKLIKAAGIEFDIAYTSVLKR
AIKTTNYALEYSDQLWVPVVKTWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVL
PPAMPRDDEYSAHADRRYANLEDSLIPDAENLKVTLERSLPFWEDQIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDDNLNLVKEYYLAPKQA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtttttgcacgtcacggtgaatcagaatggaacttggctaaccttttc
acaggttgggctgacgtggacctttcagaaaacggaacacaacaagcaattgatgcaggt
aaactcatcaaagctgcaggtatcgaatttgatatcgcgtatacttctgtattgaaacgt
gcgatcaaaactacaaactatgcacttgaatactctgaccaactttgggtaccagttgta
aaaacttggcgcttgaacgaacgtcactacggtggtttgactggcttgaacaaagctgac
gctgctgcaaaacacggtgatgagcaagttcacatctggcgccgttcatatgatgtattg
ccaccagcaatgccacgtgacgatgagtactcagcacacgctgaccgtcgttatgctaac
cttgaagacagccttattcctgatgctgaaaacctcaaagttacacttgaacgttcattg
ccattctgggaagatcaaatcgctccagcattgaaagatggtaaaaacgtattcgttggt
gcgcacggtaactcaatccgcgcattggtaaaacatatcaaacaactttcagatgatgaa
atcatggatgttgaaatccctaacttcccaccactcgtgttcgaatttgatgataatttg
aaccttgttaaggaatactaccttgcaccaaaacaagcgtaa

DBGET integrated database retrieval system