KEGG   Lactococcus garvieae ATCC 49156: LCGT_0212Help
Entry
LCGT_0212         CDS       T01618                                 

Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LCGT_0212
DNA repair and recombination proteins [BR:lgr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LCGT_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
212062..212664
Genome map
AA seq 200 aa AA seqDB search
MVYYPEPIAKLIESFSKLPGIGQKTATRLAFHTIGMDDQDVNEFARNLISAKRDLRFCSV
CGNLTESDPCAICEDPLRDRTTILVVEESKDVLAMEKIREYRGLYHVLHGTISPMNGIGP
DEINVKSLLTRLMGESEVEEVILATNATSDGEATAMYLSRMIKPAGIKVTRLARGLAVGS
DIEYADEVTLSKAVENRMEI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggtatattatccagaaccaatcgctaaacttatagaaagctttagcaaactgcccggt
atcggacaaaaaacagcaacacgtctcgcctttcacacgattggaatggatgatcaagat
gtcaatgaatttgcccgaaaccttatttcagcaaaacgtgatttacgtttttgctccgtc
tgcggtaatctgacagagagtgatccctgtgctatctgtgaagatcctctgcgtgatcgt
acaaccatattggttgtagaggaaagtaaagatgtcttagcaatggagaaaattcgcgaa
tatagagggctgtatcatgttttacatggcacgattagccccatgaatggtattggaccg
gacgagattaacgtaaaaagcctcttaactcgcctcatgggtgagagtgaagtagaagaa
gttattctcgcgacaaatgcaacatctgatggtgaagcaacggcgatgtatctttcacgg
atgattaaacccgccggaatcaaagtgacgcgcttagcgcgtggtcttgcagtcggctca
gacattgagtatgcggatgaagttaccctgtccaaagcagttgaaaatcgtatggaaatt
taa

DBGET integrated database retrieval system