KEGG   Lactococcus garvieae ATCC 49156: LCGT_0232Help
Entry
LCGT_0232         CDS       T01618                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lgr03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236942..237763
Genome map
AA seq 273 aa AA seqDB search
MPELPEVENVRRGLEKLVRNKKILEIESSYPRMVLTGFEALKKELEGQVIKDIQRRGKYL
LFDFGQWTLISHLRMEGKYRVEPLDFVKQKHDHVFVKFSDATLIYADVRKFGTWELLKSQ
DVERYFISKKIGPEPSFETFDEGIFAEKLKKSKKKIKPYLLDQTLVAGLGNIYVDEVLWR
SQVHPEMLASALSESQIHRIHDYTIEVLQTAVERGGSSIRTYKNAMGEEGSMQELLMVYG
KQGQLCPNCQHVVIEKIKVAGRGSHFCPYCQKV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttaccagaagtcgaaaatgtacgccgaggcttggaaaagctggtgagaaat
aaaaaaatattggagattgaaagttcttatccacgaatggttttaacaggattcgaggcg
ctaaaaaaagaacttgaaggtcaagtcatcaaagatatccagcgccgtgggaagtacttg
ctttttgattttggccagtggaccttgatttcccatttacgtatggaggggaaatatcgg
gtggaacccctggactttgtaaaacaaaagcatgatcatgtctttgtcaagttttcagat
gcgacacttatttatgcagatgtccgcaagtttgggacttgggaattattgaaaagtcag
gatgttgaacgttatttcatttcgaaaaagattggcccagagcccagctttgaaaccttt
gatgaggggatttttgctgaaaaactaaagaaatcgaaaaaaaagataaaaccttatctt
ttagatcagactttagttgctgggctaggaaacatctatgttgatgaggtactttggcga
tcacaagtgcatcctgaaatgttggcttcagccttgagtgaatctcaaattcaccgcatt
catgattatacgattgaagtcctccaaacggcagttgaacggggaggttctagtatacgg
acttataaaaatgcgatgggtgaggaaggaagtatgcaggaattgctcatggtttatggc
aagcaagggcaactttgtcccaattgccagcacgtggtgattgaaaagataaaggtcgca
ggacgcggctcacatttttgtccatattgtcaaaaagtatag

DBGET integrated database retrieval system