KEGG   Lactococcus garvieae ATCC 49156: LCGT_0417Help
Entry
LCGT_0417         CDS       T01618                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCGT_0417
   01230 Biosynthesis of amino acids
    LCGT_0417
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_0417
  Energy metabolism
   00680 Methane metabolism
    LCGT_0417
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCGT_0417
Enzymes [BR:lgr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     LCGT_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
434115..434819
Genome map
AA seq 234 aa AA seqDB search
MVEIYLVRHGKTMFNTIGRAQGWSDTPLTAEGERGAMELGLGFKAKGLKFDRAYSSDSGR
TIQTMGFILEYSENKDIPYKMDKRIREWCFGSFDGGYDGELFDGVLPIIFAEKGLQESGK
FPSDEELARAIYEVDTAGWAETWEELSGRIMSGFSDMATEAEAAGAKNIVIVSHGMTIAS
YIKMLRPDKERPHNLDNGSVTHLTFENGKFEVGDIGSMEYRKLGAEIVKNAKKN
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatttatttggtaagacacggaaaaacaatgtttaatacaatcggcagagcc
caaggttggtcggacacaccgctcactgctgaaggtgaacgtggtgctatggagttgggg
ctaggcttcaaagccaaagggttgaagtttgatcgtgcttattcttctgactctgggaga
acaatacaaacgatgggctttatcttagaatactcagagaataaagatattccttataag
atggacaagcgtattcgtgaatggtgttttggttcttttgatggaggctatgatggcgag
ctgtttgatggggttcttccgattatctttgctgaaaaagggttgcaagagtcaggcaaa
ttcccttcagatgaagaactggcgcgtgccatctatgaagtcgatactgcaggctgggca
gaaacctgggaagaactttctggacgtattatgagtggtttttctgatatggcaactgaa
gcagaagctgcgggagcgaaaaatattgttatagtcagtcatggcatgacgatcgctagc
tatattaaaatgcttcgtccagataaagaacggccgcataatttagataatggttctgtg
acacacctgacttttgaaaatggaaagtttgaagtaggagatatcggatcaatggagtat
cgtaaacttggagcagaaatcgtaaaaaatgcaaagaagaactaa

DBGET integrated database retrieval system