KEGG   Lactococcus garvieae ATCC 49156: LCGT_0788Help
Entry
LCGT_0788         CDS       T01618                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LCGT_0788
Enzymes [BR:lgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LCGT_0788
Exosome [BR:lgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCGT_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
808502..809998
Genome map
AA seq 498 aa AA seqDB search
MTETSYIMAIDQGTTSSRAIIFDKQGKHIGSSQKEFTQYFPKEGWVEHDANEIWNSVQSV
IAGAFIESGIKPVQVAGIGITNQRETTIIWDKKTGKPIYHAIVWQSRQSADIANGLKEAG
HEELFHKKTGLIVDSYFSATKIRWILDHVEGAQERAERGELLFGTIDTWLLWKLTDGDAH
YTDYSNASRTMLYNIHELKWDEEILKILNIPVSMLPEVKSNSEVYGVTKGFHFFGSEVPI
SGMAGDQQAALFGQMAFEPGMIKNTYGTGSFIVMNTGEKPHISKNNMLTTIGYGINGKVY
YALEGSIFVAGSSIQWLRDGLKMLERASDSEEVALQSRSQDEVYVVPAFVGLGAPYWDQE
ARGAMFGLTRGTTKEDIVKATLQGIAYQVRDVVSTMKEDTGIDMSVLKVDGGAANNEYLM
QFQADILNIPIQRAGDLETTALGAAFLAGLAVGFWKDLEELKESYEPGKIFQTQMQEERR
EELYAGWKKAVNATRAFK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacttcttacattatggcaattgaccaaggtacgacaagctcaagagctatt
atatttgataaacagggcaaacacattggcagttcccaaaaagaatttacacaatacttc
cctaaagaaggttgggttgaacatgatgccaacgagatttggaactctgttcagtctgtt
atcgcaggggcttttatcgagtcgggaattaagcctgtacaggttgcgggtatcggtatc
actaaccaacgtgaaactaccattatatgggacaagaaaacaggaaaaccaatctatcat
gctattgtttggcaatctcgtcaatcagccgatattgctaatggtcttaaagaagcagga
catgaggaactcttccataaaaagacaggacttattgtagattcatatttttcagccaca
aaaattcgttggatccttgaccatgtcgaaggagcacaagagcgtgcagaacgcggagag
ctcctctttggaaccatcgatacatggctcttgtggaagttgacagatggtgatgcacac
tatactgactattctaatgccagccgtaccatgctctacaacattcatgagttgaaatgg
gacgaagaaatcctgaaaattcttaatatcccagtttcaatgcttccagaagtcaagtcc
aactcagaagtttacggcgtgactaaaggtttccatttctttggctctgaagtgccaatc
tcaggtatggcaggggaccagcaagctgcattatttggtcaaatggcttttgaacctgga
atgattaaaaatacctatggtacaggttcgtttatcgtcatgaacacaggtgagaaacca
catatttcgaaaaataatatgcttacaacgattggttatggcattaatgggaaagtttat
tacgccttagaaggaagcatctttgttgcagggtcctctatccaatggttacgtgatggt
ttgaaaatgttggaacgtgccagtgattccgaagaagtagcactccagtctaggagtcaa
gatgaagtttatgtggtgccagcttttgtcggccttggagctccgtattgggaccaagag
gcgcgtggtgcgatgtttggcttgacacgtggaacaacaaaagaagatattgtgaaagca
accttacaagggatagcttatcaagttcgtgatgtagtcagcaccatgaaagaagataca
ggaattgatatgtctgtgctcaaggtagacggtggcgctgcaaacaatgaatatttgatg
cagttccaagctgatatcttgaatatcccaatccaacgtgcgggagatttggaaacgaca
gcacttggtgcagccttccttgcaggacttgccgttggtttctggaaagacttagaagag
cttaaagaatcctatgaaccgggcaaaattttccaaactcagatgcaagaagagcgtaga
gaagaactctatgccggttggaaaaaagccgtgaatgcgacacgcgctttcaaataa

DBGET integrated database retrieval system