KEGG   Lactococcus garvieae ATCC 49156: LCGT_0818Help
Entry
LCGT_0818         CDS       T01618                                 

Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lgr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lgr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(846715..848064)
Genome map
AA seq 449 aa AA seqDB search
MTMKTSFATLAGKSSRLVLEKIFKRGSTLPGKIALKFDPEILATLTKDYEIIVVTGTNGK
TLTTALTVGILEKAFGKVVTNTSGANMITGITATFLTAPKVKKGKKGFAVLEIDEASLPK
ITEYIKPSLFVFTNIFRDQMDRYGEIYTTYDFIVKGAANAPEATVLLNGDSPLFHSRTLV
NPVKYYGFDHESHAPERAHYNTEGVVCPECHHILDYKLNTYANLGDYICQNCGFKRPELD
YRVSELTEITNTSSQFVIDNHSYKINVGGLYNIYNALAAVSVAEFYGVPAETIKAGFEQS
KAVFGRQETFTIGDKSATIVLIKNPVGANQALEMMKLADYPFTLVSLLNANYADGIDTSW
IWDANFELVHDMDIDQIFVGGVRHSEMARRYRVSGFDESKIHEFESLPKILDALKNEADQ
HIYILATYTAMLEMRELLAQNKMIGKEMH
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgactatgaaaacttcattcgcaactttagcaggaaagagttcacgcttggttttagaa
aaaatctttaagcgtggaagcacgttgcctggtaagattgctttaaaatttgatcctgaa
attttagctacattaacaaaagattatgaaattatcgttgtgacagggaccaatggtaaa
accttgaccacagctctcactgtcggtatactcgaaaaagcttttggaaaagttgtcaca
aatacttctggtgccaatatgattaccggaattactgcgactttcttgacagcacctaag
gttaaaaaaggaaagaaaggttttgctgttctggagattgatgaagcatcactgccaaaa
atcaccgaatacatcaagccttcactctttgttttcacaaatattttccgcgaccaaatg
gaccgttatggcgagatttatacaacctatgactttatcgtcaagggtgcagcgaatgca
cctgaagccacggttctccttaatggcgatagcccgctcttccattcacggactttggtg
aatcccgtcaaatattatggttttgaccatgaaagtcatgcgcctgaacgtgcgcattac
aatactgaaggggttgtttgtccagaatgccaccacatcttagattataagctcaatact
tatgccaaccttggcgattatatctgccaaaactgcggtttcaaacgccctgagctggat
tatcgtgtctctgaactcacagaaattaccaacacttcttctcagtttgtcattgataat
cattcttataaaatcaatgtgggtggactctacaatatctacaatgcccttgctgcggtt
tctgttgctgaattttacggtgtgcctgcggaaactatcaaggcaggtttcgaacaatct
aaagccgtctttggccgtcaagaaacctttactattggagataaatccgctactattgtc
ttgattaaaaatcctgtcggagcaaatcaagcgctggaaatgatgaaacttgctgattat
ccatttactctggttagcttgctcaatgccaactatgctgacggtattgatacaagctgg
atttgggatgctaattttgagctggttcatgacatggacattgaccaaatctttgttggt
ggtgtacgtcatagcgaaatggcgcgacgttatcgtgtttctggatttgacgaaagcaaa
attcatgagtttgagtcgctaccaaaaatccttgatgccctcaaaaatgaagcggatcag
cacatctatatcctagcaacctacactgcaatgttagaaatgcgtgagttgcttgcacaa
aataagatgattggaaaggagatgcattaa

DBGET integrated database retrieval system