KEGG   Lactococcus garvieae ATCC 49156: LCGT_0842Help
Entry
LCGT_0842         CDS       T01618                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lgr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lgr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
873063..874277
Genome map
AA seq 404 aa AA seqDB search
MTLDAIKILQDVVQINSVNGNEEEVANYLRELLQEHDIESKIIPYSEGRASLVAEIGNGK
GPVIGFDGHEDTVSLGDVSKWTHHPLSATVTEEGKMYGRGTTDMKSGLVAAVVAMINLKE
SGLPLNGTVRLLATVGEEKGELGAGQLAELGYADDMEALVVCEPTGGDFTTLQQMKGTFP
LDIPEFDGEMRLIFIGHKGSVNYKVHAKGKAAHSSMPELGQNAIEGLLKFYDKQKAYFDK
LTEEDDLLGPTIPVVTLINGGEQINTVPANASMGVKIRTIPALPNEKLISDIQALIDECN
REQDVELSLEVTENVAPVKSSPDSKIVKVTSEVLEKHLQQKAPQVGVSGGTDASQFVRAN
PNLDIVVCGPGNATAHAVDEYVLVDSFLDFIKIYEDMIQKYFAS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgactttagatgctataaaaatattacaagatgtggtccaaatcaactcagtcaatggc
aacgaagaagaagtggcgaactatttacgtgaattgcttcaagagcatgatattgaatcc
aagataatcccttacagcgaaggtcgcgccagtcttgttgccgagattggcaacggcaag
ggaccggtgattggttttgacgggcatgaagatactgtttctttaggggatgtgagcaag
tggactcatcatcctttgagtgcgactgtgaccgaagagggaaaaatgtatgggcgtggc
actacagatatgaagtctggccttgtcgcagccgttgtggccatgattaatcttaaagaa
agtggccttcctctgaatggtacggtacgcttactcgctacggtaggcgaagaaaagggt
gaacttggagcagggcagcttgcagaacttggctatgccgatgatatggaagccctagtt
gtgtgcgagccaacaggtggcgactttaccacattacaacaaatgaaaggtacttttccg
ctcgatattccggagttcgacggggagatgcgtctcatttttattggacacaagggttct
gtcaactataaggtacatgccaaaggtaaagctgcacacagctcaatgccagaactgggg
caaaatgccattgaagggttacttaagttttatgataaacaaaaagcatattttgataag
ctgacagaagaagatgaccttttaggtccaactattcctgttgtgactttgattaatggt
ggcgaacagatcaatactgttccggccaatgcaagtatgggtgtaaaaatccgtaccatt
cccgcactgcctaatgaaaaattgatttccgatatacaagcactgattgatgaatgtaat
cgtgagcaagatgtagaattatctttagaggtcactgaaaatgttgcaccggtcaaaagt
agtccagactcaaaaatagtaaaagtgacttccgaagttttggaaaaacatctgcagcaa
aaagcaccacaagttggtgtatctggtggaacagatgcctcacagtttgtaagggctaat
cctaaccttgatattgtggtttgtggacccggaaatgctacagcgcacgctgttgacgag
tatgtccttgtagatagctttttggactttatcaaaatatacgaagacatgattcaaaaa
tattttgcaagttga

DBGET integrated database retrieval system