KEGG   Lactococcus garvieae ATCC 49156: LCGT_0933Help
Entry
LCGT_0933         CDS       T01618                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lgr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
962152..963594
Genome map
AA seq 480 aa AA seqDB search
MKIEFPKDFWWGAATSGPQTEGRFKKKHDNVFDYDFDHYSERFWGSIGPDTTSNFYNDFE
EDIRLMQKAGLNSIRTSIQWSRLIEDFETGKTDPQAVAFYNRVIDTFLAAGIRPMMNLHH
FDLPVELLHKYGGWESKKVAQLFAQFAEQCFRLFGDRVTEWFTHNEPIVVVECGYLLGFH
YPDLKDGKKAVQVAYNLQLASSLAIERFRKINKNAQAKIGIILNLTPNYAKDEEIQNLKA
AHFADLWQNQLFLDASVKGYFPQELVNILEQDGVLWESTTEELEIIKNNTVDFLGVNYYH
PSRVQEPEFSSDSLAQDWLPEKYYASFNKRGVRMNADRGWEIHPQTIYNIAKTIQNDYNN
IPWFISENGMGVENEARFEDKEGIIQDYYRIQFMTEHLYYLHQAISEGSACLGYHTWTPI
DCWSWRNSYKNRYGLISLDVHKQIKKLKKSAHWYRKVSESSSIDIEETLLQKLKEDEKWH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagaatttccaaaagatttttggtggggcgcagcgacaagtggtccacaaact
gaaggacgtttcaagaaaaaacacgataatgttttcgattatgactttgatcattatagt
gaacgattttggggctccattggcccagatacgaccagtaatttctataatgattttgaa
gaagatatccgtttgatgcagaaagctggactcaatagtattagaacaagtattcagtgg
tctagacttattgaggattttgagacgggaaagactgatcctcaagcggtggctttttat
aaccgcgtgattgatacttttttagcagctggcattcggcccatgatgaacttacatcat
tttgatctacctgtggagcttctccataaatatggcggctgggaaagtaaaaaagtggcc
caactctttgctcagtttgcagagcaatgtttccgcttatttggcgaccgagtaacggag
tggtttacacataatgaacccatagtagttgtcgaatgtggctatcttttaggtttccat
tatcctgaccttaaagatggtaaaaaagctgttcaggttgcctataatctacaattggct
tccagtttagctattgaaagatttagaaaaataaataaaaacgcccaagctaagattggt
atcattctcaatttaacacctaattatgccaaggacgaagaaatacagaatctcaaagca
gctcactttgctgatttgtggcaaaatcaactgtttttggatgcctcagtaaaaggatat
ttcccacaggaactcgtaaatatattagagcaagatggtgtcttgtgggaaagtacgacc
gaagagcttgaaattataaagaataatacagtggattttctaggagtaaattattaccac
ccaagtcgtgttcaagaaccagagttttcgagtgacagtttagctcaggattggctgcct
gaaaaatattatgcttcctttaacaaaagaggcgtacgtatgaatgcagacagaggctgg
gagattcacccccagacgatttataacatagcgaaaacgatacaaaatgactataataat
atcccatggttcatctccgaaaatggtatgggtgtcgaaaacgaagcacgctttgaggat
aaagaggggattatccaagattattatcgtattcaatttatgacagagcacctttactat
ttacaccaagcaatatccgaaggttcagcctgcttaggttatcatacatggacaccaata
gattgttggagctggcgtaattcgtataaaaaccgctatggattaatttccttggatgtt
cacaaacaaatcaagaaactaaaaaaatcggcacattggtatcgcaaggtttcagaaagt
tctagtattgatatcgaagaaacactgttgcaaaaactgaaagaggatgaaaaatggcat
tga

DBGET integrated database retrieval system