KEGG   Lactococcus garvieae ATCC 49156: LCGT_0946Help
Entry
LCGT_0946         CDS       T01618                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCGT_0946
Enzymes [BR:lgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LCGT_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974362..975270
Genome map
AA seq 302 aa AA seqDB search
MNKITIIGSINLDTTLRVSNMPKPGETLHAKEHFTAGGGKGANQAVAAKRSGADTFFIGA
IGKDGAGQMMRELLEYEDIDTSAVQLLESQSTGQAFITVDDSGENSIMIFSGANNAFTPE
HVENSKHIIENSDFLIAQFESALDSTVAAFKCAKENKVRTILNPAPARTDIPQELLATTD
IIVPNETEAELITGIKVEDEHSLKAAADYFHNLGIEAVIITLGSKGAYYDIKDGKSGIIP
AFKVAAVDTTAAGDTFIGALSTVLKADFSNIEDAILYGSKASSLTVQRYGAQPSIPYKNE
LD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatcacaattattggcagtatcaatctagatacaactttgagagtaagcaat
atgccgaaaccaggtgagactttacatgcaaaagaacattttactgccggtggcggtaaa
ggtgccaaccaagcggtagcagcaaagcgttctggtgctgatactttctttattggcgct
attggtaaagacggtgctgggcaaatgatgcgtgagcttttagagtatgaagatattgac
acatcagctgtccaactcttagaaagccaatcgacaggtcaagcctttattaccgtggat
gattctggtgaaaacagcattatgattttctcaggggcaaataatgcatttacccccgaa
cacgttgaaaactccaaacatattattgaaaatagtgattttttgattgcacaatttgaa
agcgcgcttgacagtacagtcgcagcctttaagtgtgcgaaagaaaataaggtgcggact
attctcaatcccgcacctgcgagaacggatattcctcaagaacttttggctacaacggat
atcattgtgcctaatgaaacagaagctgaactcataactggaataaaagtggaagatgag
cacagtctaaaagctgcggcagattatttccacaatcttggtattgaagcagtgattatt
accttaggaagcaagggggcttattatgacatcaaagatggcaagtctggtatcatcccc
gctttcaaggtagcggctgtcgatacaacagctgcaggtgatactttcattggcgcttta
agcactgttttgaaggcagacttcagtaatattgaggatgctattctttatggcagtaaa
gcctcatcactgactgtacaaagatacggcgcacaaccctctattccctacaaaaatgaa
ctggattag

DBGET integrated database retrieval system