KEGG   Lactococcus garvieae ATCC 49156: LCGT_1026Help
Entry
LCGT_1026         CDS       T01618                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lgr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1057801..1058874)
Genome map
AA seq 357 aa AA seqDB search
MKIIEKNTECFSLKHISICFTEMSSQEQAKLDNLLYRVRAKTLVDKHDLLAFLTIYELAD
LIKVWPASQEKLALERIFKRHQIIWSGQNFSFDLTLDPIVYSIVNVTPDSFYDGAEENLN
LDFILQRVEQDLQEGAQVIELGGKSSRPGYADISPEEEWQRLAQPLQNIRQAFPEAVIAI
DTDEAYVMQRALDAGADIINDIDGFDTPEKLQLMQEYQPALVAMNNGRAGMNYADNVYQE
LPAYFTEKQKELNQLDIANAQICVDPGVGFSGGATGIDSLQRVKTTELLTNLGLPVMIAI
SRKSFMTNLLNMEVDERLLSTLILENQMMMDGGRVLRVHDVAATRRLIENFKIYQKY
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcattgaaaaaaatacagagtgcttttctctgaagcatatctctatctgtttc
accgaaatgagcagtcaagaacaagccaaattggacaatctactgtaccgtgtaagagca
aaaacgctcgtagacaagcatgatctgctggcttttttgacgatttatgaattggcagat
ttgattaaggtttggcctgcttctcaggaaaaattggctttggagcgtatttttaaacgc
catcagattatttggtcaggacagaatttttcttttgatttgactttggatccgattgtt
tactctattgtcaatgtcacacctgattcattttacgatggcgcagaagaaaatctgaat
ttggattttattctacagcgagtggaacaggatttgcaagagggggcacaagtcatcgaa
cttggaggtaagtcttctcgcccaggttatgcagacatttcgccagaagaagaatggcaa
cgtcttgctcagcccttgcagaatattcgtcaagcatttcccgaggctgttattgctata
gacactgatgaagcctatgttatgcagcgtgcgctggatgcaggtgcagatattattaat
gatattgatggtttcgatacacctgaaaaattacagctgatgcaagaataccaaccagct
ttggttgccatgaataatggtcgagcgggcatgaattacgcagataacgtttatcaagaa
ctgccggcctattttacagaaaaacaaaaagaattaaaccaacttgatattgctaatgca
caaatatgtgtagacccaggcgttggtttttctggtggagcaacagggattgactcttta
cagcgcgtaaaaacgaccgaactattgacgaacctaggtttgcctgtgatgattgcaatc
tcccgtaaatctttcatgaccaatcttctgaatatggaagtagacgagcgccttttgtca
acattgattcttgaaaatcaaatgatgatggatggtgggcgtgtgctacgtgtacatgat
gttgcagcaacacgacgtttaattgaaaattttaaaatataccaaaaatactaa

DBGET integrated database retrieval system