KEGG   Lactococcus garvieae ATCC 49156: LCGT_1221Help
Entry
LCGT_1221         CDS       T01618                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00071  Fatty acid degradation
lgr00072  Synthesis and degradation of ketone bodies
lgr00280  Valine, leucine and isoleucine degradation
lgr00362  Benzoate degradation
lgr00380  Tryptophan metabolism
lgr00620  Pyruvate metabolism
lgr00630  Glyoxylate and dicarboxylate metabolism
lgr00640  Propanoate metabolism
lgr00650  Butanoate metabolism
lgr00900  Terpenoid backbone biosynthesis
lgr01100  Metabolic pathways
lgr01110  Biosynthesis of secondary metabolites
lgr01120  Microbial metabolism in diverse environments
lgr01130  Biosynthesis of antibiotics
lgr01200  Carbon metabolism
lgr01212  Fatty acid metabolism
lgr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCGT_1221
   00630 Glyoxylate and dicarboxylate metabolism
    LCGT_1221
   00640 Propanoate metabolism
    LCGT_1221
   00650 Butanoate metabolism
    LCGT_1221
  Lipid metabolism
   00071 Fatty acid degradation
    LCGT_1221
   00072 Synthesis and degradation of ketone bodies
    LCGT_1221
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LCGT_1221
   00310 Lysine degradation
    LCGT_1221
   00380 Tryptophan metabolism
    LCGT_1221
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCGT_1221
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LCGT_1221
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LCGT_1221
Enzymes [BR:lgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LCGT_1221
Exosome [BR:lgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCGT_1221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAK58734
Position
complement(1213063..1214205)
Genome map
AA seq 380 aa AA seqDB search
MKEIVIIDALRTPVGKYDGALSDKTAAELGVHVVKNLLDRHEDIKDDVKQVIFGNVLQAG
TGQNIARQISINSGLSHHVPASTVNEVCGSGMKAVILAKQLLQLEEADVVIAGGTESMSQ
SPIIRHRKSGEEVLSMMSEGLIDAFNGESMGLIGETIAEQFEISREEQDRFAQRSQEKAL
AARTTGAFEKEIVPFSDLAEDETIRANSSLEKLSSLRTAFSENGSVTAGNSSPVNDGASA
LLLASNDYAEAKDLPVLAKLLASEEVGIDPEIMGVSPIRAIRQLLERTDLDIEDIDIFEI
NEAFAASSVAVNQELNIPEEKVNIYGGAIALGHAIGSSGARVLTTLAYALQRENKRYGIA
SVCIGGGLGLAVLLENPNLV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaatagtaattatcgatgcgcttcgtacgcctgtcggaaaatatgatggtgct
ctgtcagataagacagctgcagaactgggtgttcatgtagttaaaaatctacttgatcgc
catgaagatattaaagatgacgtcaaacaagtgatttttggcaatgtactacaggctggt
acagggcaaaatattgcacgtcagatctcaatcaatagtggtctatctcaccatgttcca
gcttcaacggttaatgaagtctgtggttcaggtatgaaggcagtgattctcgctaaacaa
cttttacaacttgaggaagcggatgttgtgattgctgggggaacagagtccatgtctcaa
tctccaatcatccgtcaccgtaaatctggtgaagaagtgctttcaatgatgtctgagggc
ttaatagatgcgtttaatggtgaatcaatggggttgattggtgaaacaatcgccgagcaa
tttgaaattagccgtgaagaacaagatcgctttgctcaacgttcgcaagaaaaagcccta
gctgcacgtacaacgggtgcatttgaaaaagaaattgtgccattttcagatttagcagaa
gatgaaacaattcgtgcaaactcttcattagaaaaactttcttcactgcgtactgctttc
agtgagaacggcagtgtaactgcaggtaactcatcacccgtaaatgacggtgcgtccgct
ttgcttttagcaagcaatgactatgccgaagcaaaagatcttccagttttggcaaaatta
ttagccagtgaagaagttgggattgatcctgaaattatgggtgtttcaccgattagggcc
attcgtcagttgcttgaacgtacagatttggatattgaagatattgatatattcgaaatc
aatgaagcttttgcagcatctagcgttgctgtaaatcaagaactcaatattccagaagaa
aaagtgaatatttatggtggcgctattgctttagggcatgctatcggttcatcaggagca
cgtgttctgactactttagcttatgcgcttcaacgcgaaaataaacgttatggtattgcc
agcgtttgtattggtggcggtcttggtttggctgtcctcttggaaaaccctaatttagtt
taa

DBGET integrated database retrieval system