KEGG   Lactococcus garvieae ATCC 49156: LCGT_1282Help
Entry
LCGT_1282         CDS       T01618                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCGT_1282
   01230 Biosynthesis of amino acids
    LCGT_1282
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_1282
   00051 Fructose and mannose metabolism
    LCGT_1282
   00562 Inositol phosphate metabolism
    LCGT_1282
Enzymes [BR:lgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LCGT_1282
Exosome [BR:lgr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LCGT_1282
  Exosomal proteins of bladder cancer cells
   LCGT_1282
  Exosomal proteins of melanoma cells
   LCGT_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1280648..1281406)
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKLNKNLKEVKEFIANIDGKLPSEDKVEVAIAAPALYLVSMVQERGNNPL
KVAAENVYFENSGAFTGEIAPAMLAAEGIEYSVIGHSERREYFHETDEDINKKAKALIAA
GVTPILCCGETLETFEAGKTAEWVSAQIEAGLAGIDGKDVANMVIAYEPIWAIGTGKTAT
AEIADETCGVVRSTVEKLYGKEVSDAVRIQYGGSVKPETVAELMSKENIDGALVGGASLE
ADSFLGLLEIYK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaacctattatcgctggtaactggaaattgaataaaaacctcaaagaggtt
aaagaattcatcgctaacattgacggtaaattgccatcagaagacaaagtagaagttgca
atcgcagctcctgcactttaccttgtatcaatggtacaagaacgtggaaataacccactt
aaagttgcagctgaaaatgtttactttgaaaattcaggtgccttcactggtgaaatcgct
ccagctatgcttgcagcagaaggaatcgaatactcagtaatcggtcacagtgaacgtcgt
gagtacttccacgaaacagacgaagacatcaataaaaaagctaaagcgcttatcgcagct
ggtgtaacaccaatcctttgctgtggtgaaacacttgaaacttttgaagctggtaaaaca
gctgaatgggtttcagctcaaatcgaagctggtcttgctggtatcgacggtaaagatgtt
gcgaacatggttatcgcttacgaaccaatctgggctatcggtacaggtaaaactgcgaca
gctgaaatcgctgacgaaacttgtggtgttgttcgttcaacagttgaaaaactttacgga
aaagaagtttcagatgctgtacgtattcaatacggtggttctgtaaaacctgaaacagtt
gctgaacttatgtctaaagaaaatatcgacggtgccttggttggtggagcttcacttgaa
gctgattcattccttggcttgcttgaaatttacaaataa

DBGET integrated database retrieval system