KEGG   Lactococcus garvieae ATCC 49156: LCGT_1316Help
Entry
LCGT_1316         CDS       T01618                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCGT_1316
   01230 Biosynthesis of amino acids
    LCGT_1316
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_1316
   00030 Pentose phosphate pathway
    LCGT_1316
   00051 Fructose and mannose metabolism
    LCGT_1316
   00052 Galactose metabolism
    LCGT_1316
  Energy metabolism
   00680 Methane metabolism
    LCGT_1316
Enzymes [BR:lgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LCGT_1316
Protein phosphatases and associated proteins [BR:lgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LCGT_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1321146..1322174)
Genome map
AA seq 342 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
VGRGGTFLYSARFPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDAIDKIRDTSSSHHRTFVVEVMGRNAGDIALWS
GIAAGADDIAIPEKEFKFESIVRNIKSGYAKGKNHHIIVVAEGVMSGEEFAMKLKAAGDD
SDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGVRNEQLVESPILGT
AEENALFSLTDEGKIVVNNPHKAGLELYRLNADLNNLDIKFN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgcaccaggtatgaacgcagctatt
cgtgctgttgttcgtaaagcgatttctgaaggtatcgaagtttacggtatcaaccacgga
tatgcagggatggtagcgggcgatattttcccactaacatctgcaagtgttggtgataaa
gttggacgtggcggtacattcttgtattcagcacgtttcccagagtttgctcaacttgaa
gggcaacttgcgggtatcgagcaacttaaaaaacatggcatcgaaggtgttgttgttatt
ggtggtgatggttcttatcatggtgcaatgcgcttgactgagcatggcttcccagcagta
ggacttccaggtactattgataacgacatcgttggtacagattttacaatcggtttcgat
acagctgtttctacagttgtggatgccattgataaaattcgtgatacatcatcatctcac
caccgtactttcgttgttgaagttatgggacgtaacgctggagatatcgcgctttggtct
ggtatcgctgcaggtgctgatgatattgcaattcctgaaaaagaattcaaatttgaaagt
atcgtacgtaatatcaaatcaggatatgctaaaggtaaaaaccaccacatcatcgtagta
gctgaaggcgttatgtcgggtgaagaatttgccatgaagcttaaagctgctggtgatgat
tctgaccttcgtgtatctgttcttggtcacatccaacgtggtggatcacctacagcgcgc
gatcgcgttcttgcatcacgcatgggtgctcgtgcagtagaattgcttcgtgatggtatt
ggcggtgttgctgtcggtgtccgtaacgaacaacttgtcgaaagcccaattcttggtact
gcagaagaaaatgcccttttcagtctgacagatgaaggtaaaatcgttgtcaacaatcca
cacaaagctggattggaactctatcgtttaaacgctgatttaaacaatcttgacatcaaa
tttaattaa

DBGET integrated database retrieval system