KEGG   Lactococcus garvieae ATCC 49156: LCGT_1331Help
Entry
LCGT_1331         CDS       T01618                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lgr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lgr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lgr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lgr00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1332677..1333603
Genome map
AA seq 308 aa AA seqDB search
MIKANPKQKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDIL
IVTGKAKRPIEDHFDSNIELEQNLKEKGKTELLKLVEETTDINLHFIRQSHPMGLGHAVL
QAKAFVGDEPFVVMLGDDLMNIMGDGTPLTKELISDYEKTHASTIAVMKVPHDDVDKYGV
IAPEGEVSKGLYNVAEFVEKPAVEDAPSDLAIIGRYLLTPEIFQVLEKQKPGAGNEIQLT
DAIETLNKTQRVFAHEFTGKRYDVGDKFGFVETTIEYGLNHPQIKDELHDYIIAKAKELS
KSESKTEK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagcaaatccaaaacaaaaagtaagaaaagcaattattcccgcagctggtctg
ggcacacgtttccttcctgctactaaagccctagctaaagaaatgttacctattgttgat
aagccaaccattcaatttattgttgaagaagccttaaaatcaggaattgaagatatctta
atcgttacaggtaaagctaaacgtccgatcgaagaccactttgactcaaacattgagttg
gaacaaaaccttaaagaaaaagggaaaacagagcttttaaaattagttgaagaaacaaca
gatatcaatcttcacttcattcgtcaaagtcacccaatggggctcggacatgcggttcta
caagcaaaagcctttgttggtgatgaaccttttgttgtaatgctcggtgatgatctcatg
aacatcatgggggatggtacaccactcacaaaagaattgatttccgactacgaaaagaca
cacgcttcaacaatcgctgtaatgaaagttccacatgatgatgtggataaatatggtgtt
attgctccagaaggtgaagtttccaaaggtctttacaatgtcgcagaattcgttgaaaaa
cctgccgttgaggatgcgccttctgatttagctatcatcggtcgctacctcttaactcca
gaaattttccaagttttagaaaaacaaaaacctggtgcaggtaacgaaatccaattgaca
gatgcgattgaaactttaaataaaacacaacgcgtttttgcacacgagttcacaggcaaa
cgttatgatgtcggcgataaatttggttttgttgaaacaactatcgaatatggccttaat
catccccaaatcaaagatgaattgcatgattacatcatcgccaaagcaaaagaactttca
aagtctgaaagcaaaactgaaaaataa

DBGET integrated database retrieval system