KEGG   Lactococcus garvieae ATCC 49156: LCGT_1461Help
Entry
LCGT_1461         CDS       T01618                                 

Definition
ketose-bisphosphate aldolase
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:lgr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lgr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lgr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lgr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lgr00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:lgr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1444511..1445368)
Genome map
AA seq 285 aa AA seqDB search
MVLVKSKEMIEKAFKNGYAIGAFNAENMEMAEAIVEAAQEMNAPVIVQTTSGTLNTTPPE
MFYHMVKAAADKVSVPVVMHLDHGDDFERVARCLRTGYTSVMIDASKKPFEENVAITEEV
VKMAHSMGIPVEAELGIVGGKEDGNNAETLAFTDPEEAEKFVKATNVDFLAIGIGNSHGF
YKAEPKLQYDILEAVKAKTGDVPLVLHGTSGIPDEDVSKAVAMGIAKVNYATELRAVFTN
AIKSYISEDEKVVDPKKYNSAAKQAVKELVKQKIQVLGSDGKAEE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggtacttgtaaaaagtaaagaaatgatagaaaaggcatttaaaaacggctatgccatt
ggtgcctttaatgcagaaaatatggaaatggcggaagcaatcgtagaagcggcacaagag
atgaatgcccccgtcattgtccaaacaacttcgggtacgctcaatacgacacccccagaa
atgttctaccatatggttaaagcagcagcagacaaggtctcagtgcctgtagtgatgcat
cttgatcatggggatgattttgaacgcgtagcacgttgcttgcgtacaggttatacctcg
gtaatgattgacgcttcgaaaaaaccatttgaagaaaatgtcgcaataactgaagaagtg
gtcaagatggcacattcgatgggtattccagtagaagctgaactaggtattgttggtggc
aaagaagatggcaataatgcagagacgctagcttttaccgatccagaagaagctgaaaaa
tttgtcaaagctacaaatgttgactttttagctattggcatcggcaactcacacggcttt
tataaagcagagccaaagttacagtatgatatcttagaggctgtcaaagcgaaaaccggt
gatgtaccattggtgcttcacggcacatcaggcatccctgacgaagatgtttcaaaagct
gttgctatggggattgctaaggttaactatgccactgaacttcgcgctgtgttcacaaat
gccatcaaatcctatatctccgaagatgaaaaagtcgtagatccgaaaaaatacaactcc
gcagctaaacaagcagtcaaagaacttgtgaaacaaaaaattcaagtgcttggttctgat
gggaaggcggaggagtga

DBGET integrated database retrieval system