KEGG   Lactococcus garvieae ATCC 49156: LCGT_1461Help
Entry
LCGT_1461         CDS       T01618                                 

Definition
ketose-bisphosphate aldolase
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCGT_1461
   01230 Biosynthesis of amino acids
    LCGT_1461
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_1461
   00030 Pentose phosphate pathway
    LCGT_1461
   00051 Fructose and mannose metabolism
    LCGT_1461
  Energy metabolism
   00680 Methane metabolism
    LCGT_1461
Enzymes [BR:lgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     LCGT_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1444511..1445368)
Genome map
AA seq 285 aa AA seqDB search
MVLVKSKEMIEKAFKNGYAIGAFNAENMEMAEAIVEAAQEMNAPVIVQTTSGTLNTTPPE
MFYHMVKAAADKVSVPVVMHLDHGDDFERVARCLRTGYTSVMIDASKKPFEENVAITEEV
VKMAHSMGIPVEAELGIVGGKEDGNNAETLAFTDPEEAEKFVKATNVDFLAIGIGNSHGF
YKAEPKLQYDILEAVKAKTGDVPLVLHGTSGIPDEDVSKAVAMGIAKVNYATELRAVFTN
AIKSYISEDEKVVDPKKYNSAAKQAVKELVKQKIQVLGSDGKAEE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggtacttgtaaaaagtaaagaaatgatagaaaaggcatttaaaaacggctatgccatt
ggtgcctttaatgcagaaaatatggaaatggcggaagcaatcgtagaagcggcacaagag
atgaatgcccccgtcattgtccaaacaacttcgggtacgctcaatacgacacccccagaa
atgttctaccatatggttaaagcagcagcagacaaggtctcagtgcctgtagtgatgcat
cttgatcatggggatgattttgaacgcgtagcacgttgcttgcgtacaggttatacctcg
gtaatgattgacgcttcgaaaaaaccatttgaagaaaatgtcgcaataactgaagaagtg
gtcaagatggcacattcgatgggtattccagtagaagctgaactaggtattgttggtggc
aaagaagatggcaataatgcagagacgctagcttttaccgatccagaagaagctgaaaaa
tttgtcaaagctacaaatgttgactttttagctattggcatcggcaactcacacggcttt
tataaagcagagccaaagttacagtatgatatcttagaggctgtcaaagcgaaaaccggt
gatgtaccattggtgcttcacggcacatcaggcatccctgacgaagatgtttcaaaagct
gttgctatggggattgctaaggttaactatgccactgaacttcgcgctgtgttcacaaat
gccatcaaatcctatatctccgaagatgaaaaagtcgtagatccgaaaaaatacaactcc
gcagctaaacaagcagtcaaagaacttgtgaaacaaaaaattcaagtgcttggttctgat
gggaaggcggaggagtga

DBGET integrated database retrieval system