KEGG   Lactococcus garvieae ATCC 49156: LCGT_1461Help
Entry
LCGT_1461         CDS       T01618                                 

Definition
(GenBank) ketose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00010  Glycolysis / Gluconeogenesis
lgr00030  Pentose phosphate pathway
lgr00051  Fructose and mannose metabolism
lgr00680  Methane metabolism
lgr01100  Metabolic pathways
lgr01110  Biosynthesis of secondary metabolites
lgr01120  Microbial metabolism in diverse environments
lgr01130  Biosynthesis of antibiotics
lgr01200  Carbon metabolism
lgr01230  Biosynthesis of amino acids
Module
lgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_1461
   00030 Pentose phosphate pathway
    LCGT_1461
   00051 Fructose and mannose metabolism
    LCGT_1461
  Energy metabolism
   00680 Methane metabolism
    LCGT_1461
Enzymes [BR:lgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     LCGT_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase PEP_mutase Linker_histone ThiG PK_C
Motif
Other DBs
NCBI-ProteinID: BAK58974
Position
complement(1444511..1445368)
Genome map
AA seq 285 aa AA seqDB search
MVLVKSKEMIEKAFKNGYAIGAFNAENMEMAEAIVEAAQEMNAPVIVQTTSGTLNTTPPE
MFYHMVKAAADKVSVPVVMHLDHGDDFERVARCLRTGYTSVMIDASKKPFEENVAITEEV
VKMAHSMGIPVEAELGIVGGKEDGNNAETLAFTDPEEAEKFVKATNVDFLAIGIGNSHGF
YKAEPKLQYDILEAVKAKTGDVPLVLHGTSGIPDEDVSKAVAMGIAKVNYATELRAVFTN
AIKSYISEDEKVVDPKKYNSAAKQAVKELVKQKIQVLGSDGKAEE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggtacttgtaaaaagtaaagaaatgatagaaaaggcatttaaaaacggctatgccatt
ggtgcctttaatgcagaaaatatggaaatggcggaagcaatcgtagaagcggcacaagag
atgaatgcccccgtcattgtccaaacaacttcgggtacgctcaatacgacacccccagaa
atgttctaccatatggttaaagcagcagcagacaaggtctcagtgcctgtagtgatgcat
cttgatcatggggatgattttgaacgcgtagcacgttgcttgcgtacaggttatacctcg
gtaatgattgacgcttcgaaaaaaccatttgaagaaaatgtcgcaataactgaagaagtg
gtcaagatggcacattcgatgggtattccagtagaagctgaactaggtattgttggtggc
aaagaagatggcaataatgcagagacgctagcttttaccgatccagaagaagctgaaaaa
tttgtcaaagctacaaatgttgactttttagctattggcatcggcaactcacacggcttt
tataaagcagagccaaagttacagtatgatatcttagaggctgtcaaagcgaaaaccggt
gatgtaccattggtgcttcacggcacatcaggcatccctgacgaagatgtttcaaaagct
gttgctatggggattgctaaggttaactatgccactgaacttcgcgctgtgttcacaaat
gccatcaaatcctatatctccgaagatgaaaaagtcgtagatccgaaaaaatacaactcc
gcagctaaacaagcagtcaaagaacttgtgaaacaaaaaattcaagtgcttggttctgat
gggaaggcggaggagtga

DBGET integrated database retrieval system