KEGG   Lactococcus garvieae ATCC 49156: LCGT_1461Help
Entry
LCGT_1461         CDS       T01618                                 

Definition
ketose-bisphosphate aldolase
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCGT_1461
   01230 Biosynthesis of amino acids
    LCGT_1461
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_1461
   00030 Pentose phosphate pathway
    LCGT_1461
   00051 Fructose and mannose metabolism
    LCGT_1461
  Energy metabolism
   00680 Methane metabolism
    LCGT_1461
Enzymes [BR:lgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     LCGT_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1444511..1445368)
Genome map
AA seq 285 aa AA seqDB search
MVLVKSKEMIEKAFKNGYAIGAFNAENMEMAEAIVEAAQEMNAPVIVQTTSGTLNTTPPE
MFYHMVKAAADKVSVPVVMHLDHGDDFERVARCLRTGYTSVMIDASKKPFEENVAITEEV
VKMAHSMGIPVEAELGIVGGKEDGNNAETLAFTDPEEAEKFVKATNVDFLAIGIGNSHGF
YKAEPKLQYDILEAVKAKTGDVPLVLHGTSGIPDEDVSKAVAMGIAKVNYATELRAVFTN
AIKSYISEDEKVVDPKKYNSAAKQAVKELVKQKIQVLGSDGKAEE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggtacttgtaaaaagtaaagaaatgatagaaaaggcatttaaaaacggctatgccatt
ggtgcctttaatgcagaaaatatggaaatggcggaagcaatcgtagaagcggcacaagag
atgaatgcccccgtcattgtccaaacaacttcgggtacgctcaatacgacacccccagaa
atgttctaccatatggttaaagcagcagcagacaaggtctcagtgcctgtagtgatgcat
cttgatcatggggatgattttgaacgcgtagcacgttgcttgcgtacaggttatacctcg
gtaatgattgacgcttcgaaaaaaccatttgaagaaaatgtcgcaataactgaagaagtg
gtcaagatggcacattcgatgggtattccagtagaagctgaactaggtattgttggtggc
aaagaagatggcaataatgcagagacgctagcttttaccgatccagaagaagctgaaaaa
tttgtcaaagctacaaatgttgactttttagctattggcatcggcaactcacacggcttt
tataaagcagagccaaagttacagtatgatatcttagaggctgtcaaagcgaaaaccggt
gatgtaccattggtgcttcacggcacatcaggcatccctgacgaagatgtttcaaaagct
gttgctatggggattgctaaggttaactatgccactgaacttcgcgctgtgttcacaaat
gccatcaaatcctatatctccgaagatgaaaaagtcgtagatccgaaaaaatacaactcc
gcagctaaacaagcagtcaaagaacttgtgaaacaaaaaattcaagtgcttggttctgat
gggaaggcggaggagtga

DBGET integrated database retrieval system