KEGG   Lactococcus garvieae ATCC 49156: LCGT_1862Help
Entry
LCGT_1862         CDS       T01618                                 

Definition
alcohol-acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lgr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LCGT_1862
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGT_1862
   00620 Pyruvate metabolism
    LCGT_1862
   00650 Butanoate metabolism
    LCGT_1862
  Lipid metabolism
   00071 Fatty acid degradation
    LCGT_1862
  Amino acid metabolism
   00350 Tyrosine metabolism
    LCGT_1862
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LCGT_1862
   00626 Naphthalene degradation
    LCGT_1862
Enzymes [BR:lgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LCGT_1862
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LCGT_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1856005..1858698
Genome map
AA seq 897 aa AA seqDB search
MSSKNTKKELTAADKATLVEKAEQYTDGLVKKAHQAALQFEDYTQAQVDKIVAAMALAAS
EHSLELAHEAHNETGRGIVEDKDTKNRFASESVYNSIKNDKTVGVISENKVAGSVEIAAP
LGVLAGIVPTTNPTSTTIFKSLLTAKTRNAIVFAFHPQAQNCSSHAARIVYEAALKAGAP
ENFIQWVEDPSLYNTTALIQNHGIASILATGGPGMVNAALKSGNPSLGVGAGNGAVFVDA
TANVDRAVEDLLLSKRFDNGMICATENSAVVAAEIYDEFLEKLQAHGAYVVPKEDYPAIE
KFVFVERAGEGFGVTGPVAGRPGPWIAEQAGVQVPEGKDVLLFELDEKNIGEALSSEKLS
PLLSIYKSTSRENGTAIVQKLLAYQGAGHNAAIQIGAQDDPFVKEYADAIGAARILVNQP
DSIGGVGDIYTDAMRPSLTLGTGSWGKNSISHNLSTYDLLNIKTVARRRNRPQWVRLPKE
IYYENNSISYLQEMPNIERAFVVTDHGMLQFGFVDHMLEQLAVRETQVQTSIYGSVKPDP
TLSQAIEIARQMADFKPDTVIALGGGSPLDAAKIGRLIYEYSARGEVDLNDDAALKALFE
QLAQKFIDIRKRIVKFPHQDQTQLVCIPTTSGTGSEVTPFAVITDDETHVKYPLADYQLT
PQVAIVDPEFVMTVPKRTVAWSGIDALSHALESYVSVMASDYTKPLSLRAIKLIFDNLTT
SYQYDPSKPSKEGQVARANMHNAATLAGMAFANAFLGINHSLAHKVGGEFELPHGLAIAI
AMPHVIKFNAVTGNVKRTPYPRYEIYRAQEDYAEIARYIGLTGKDDAELVDKLIKEIKKL
TDSIDIDVTLSGNGVDKNHLERELDKLANLVYDDQCTPGNPRQPSISELKTLLQDQY
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcaagaataccaaaaaagaactaacagccgctgataaagctacacttgtagaa
aaagcagagcaatatacagacggtctcgtcaaaaaagcacatcaagctgctttgcagttt
gaagactacacacaagcgcaagtagataaaattgtcgcagcaatggccttagccgcaagc
gaacattcccttgaactcgcacacgaagcccataatgaaacaggccgaggaatcgttgag
gataaggatactaaaaatcgctttgcttcagaatctgtttataactccatcaaaaatgac
aaaacagtcggagtaatcagcgagaacaaagttgctggctcagtagaaatcgcagcccct
ttaggcgtgcttgcaggaatcgtacctactaccaaccctacttctacaacaattttcaaa
tcactcttaacagcaaaaacacgaaacgctatcgttttcgcctttcaccctcaagcacaa
aattgttcctctcatgccgcacgtattgtctacgaagctgctctgaaggccggggcccca
gaaaactttatccaatgggtcgaagatccaagtctttataacactaccgcacttatccaa
aaccacggtattgcttctatcctcgctacaggtggaccagggatggtcaatgcagcgctc
aagtcaggtaatccttccttaggcgtgggggcaggtaatggtgccgtctttgttgatgct
actgcaaatgttgaccgtgcagttgaagacctgctactttctaaacgatttgacaacggc
atgatttgcgctaccgaaaactctgctgtagttgctgcagaaatttacgatgaattcctc
gaaaaacttcaagctcacggtgcttacgttgtaccaaaagaagattatccagccatcgaa
aaatttgttttcgtcgaacgtgcaggtgaaggcttcggtgtaacggggccggttgccggt
cgtcctggaccgtggattgctgagcaagctggcgtacaagtacctgaaggtaaagatgtt
cttctctttgaattggatgaaaaaaacatcggggaagccctctcttctgaaaagctcagc
ccgcttttgtcaatttacaaatctacttcacgcgaaaatggtaccgcaatcgtccaaaaa
cttttagcctatcaaggggctggacacaacgcagctatccagataggtgcgcaagatgat
ccttttgtgaaagaatatgctgatgctattggtgctgcacgtatcttagtcaaccaaccc
gattctattggtggcgttggggatatctatactgacgcaatgcgtccatcactgacttta
ggaactggttcatgggggaaaaattcaatctcacacaatttgagtacatatgatctattg
aatatcaaaacagtggcacgtcgtcgtaatcgcccacaatgggttcgtctgccaaaagaa
atttactacgaaaacaactctatttcttacttacaagaaatgcctaatatcgaacgcgct
tttgtcgtcaccgaccacggtatgctgcaatttggctttgtcgaccatatgcttgagcaa
ttggccgttcgtgaaacacaagtacaaacttcaatttatggttctgtaaaacctgaccca
acactttcacaagccattgaaattgcgcgacaaatggctgattttaaacctgacacagtt
atcgctctcggcggtgggtctccacttgatgcagcaaaaattgggcgcttgatttacgag
tattctgctcgtggagaggttgacctcaatgacgatgccgcactaaaagcactctttgag
cagttggctcaaaaattcatcgatattcgtaaacgtatcgtcaaattcccgcatcaagat
caaacacagctagtatgtatcccgaccacttctggtacaggttctgaagtaacaccattt
gctgtcatcaccgatgatgaaacacatgttaaatatcctttagctgattatcaacttaca
cctcaagtagccatcgttgatcctgagtttgttatgactgtgccaaaacgtaccgtggct
tggtctggtattgatgcccttagtcacgcacttgaatcttatgtttcagtcatggcttcg
gattacactaaaccattgtcacttcgtgctattaagttaatttttgataatttgacaacc
tcatatcagtacgacccatcaaaaccttccaaagaagggcaagtcgcacgcgctaatatg
cacaatgcagcaaccttagctggtatggcctttgccaatgcctttctcggtattaatcac
tccctcgcccacaaagtgggaggtgagtttgaattaccacatggtttagctatcgctatc
gctatgcctcacgtcattaaatttaacgctgtaacaggaaacgttaaacgtacaccatac
ccacgttatgagatttaccgtgcccaagaagattacgctgaaattgcgcgttacatcggt
cttacaggtaaagatgatgcggagcttgtagacaaacttattaaagaaattaaaaaattg
acggacagcatcgatatcgatgtcactctatccggaaatggtgttgataaaaaccacttg
gagcgtgaactcgataagcttgcaaaccttgtttacgacgatcaatgcacaccaggtaat
ccacgccaaccaagtatttcagagcttaaaacactcttacaagatcaatattaa

DBGET integrated database retrieval system