KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_0220Help
Entry
LEGAS_0220        CDS       T01267                                 

Gene name
adhE
Definition
(GenBank) Aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00010  Glycolysis / Gluconeogenesis
lgs00071  Fatty acid degradation
lgs00350  Tyrosine metabolism
lgs00620  Pyruvate metabolism
lgs00625  Chloroalkane and chloroalkene degradation
lgs00626  Naphthalene degradation
lgs00650  Butanoate metabolism
lgs01100  Metabolic pathways
lgs01110  Biosynthesis of secondary metabolites
lgs01120  Microbial metabolism in diverse environments
lgs01130  Biosynthesis of antibiotics
lgs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_0220 (adhE)
   00620 Pyruvate metabolism
    LEGAS_0220 (adhE)
   00650 Butanoate metabolism
    LEGAS_0220 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LEGAS_0220 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LEGAS_0220 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LEGAS_0220 (adhE)
   00626 Naphthalene degradation
    LEGAS_0220 (adhE)
Enzymes [BR:lgs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LEGAS_0220 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LEGAS_0220 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 PD-C2-AF1
Motif
Other DBs
NCBI-ProteinID: CBL90868
Position
210200..212902
Genome map
AA seq 900 aa AA seqDB search
MADTIVKKPVKKVLTPEEKAELQIQAEAMTAALVEKSKIALATFSTYTQKQVDKIVAAMA
LAGSENSLVLAHAAYDETGRGVVEDKDTKNRFASESVYNAIKFDKTVGVISEDKIQGKVE
LAAPLGVLAGIVPTTNPTSTTIFKSMLTAKTRNTIIFAFHPQAQKSSALAAKIVYDAAVK
AGAPENFIQWIEKPSLYGTSALIQNHSIASILATGGPAMVNAALKSGNPSMGVGAGNGAI
YLDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQAPIYDEVLQKMQDQGAYLVPKKDY
KKIADYVFKPNAEGFGIAGPVAGMSGRWIAEQAGVKIPEGKDVLLFELDQKNIGEALSSE
KLSPLLSIYKVEKREEAIKTVQSLLNYQGAGHNAAIQIGSQDDPFIKEYADAIGASRILV
NQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWIRL
PKEVYYEANAITYLQELPSIKRAFIVADPGMVQFGFVGKVLSQLELRQEQVETNIYGSVK
PDPTLSQAVDIARQMAAFKPDTVILLGGGSALDAGKIARFLYEYSTRHEGILEDEDGIKE
LFMELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDQTHVKYPLADY
ELTPEVAIVDPEFVMTVPKRTVAFSGLDALSHAFESYVSVMASEFTRPWALQAIKLIFDN
LTTSYQYDPKNPTKEGQNARTKMHYASTLAGMSFANAFLGINHSLAHKTGGEFGLPHGLA
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARYLGLKGNTDAEMVDALIAAV
KTLAKSVEVDQTLTGNGVKKADLESNIDQLTDLVYNDQCTPGNPRQPSLEEIKQLLRDQL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcagatacaattgtaaaaaagcccgtaaaaaaggttttgacacctgaagaaaaagca
gaactacaaatacaagctgaagcaatgacagcagcattagttgaaaaatcaaaaatagca
ttagcaacgttttcgacctatacacagaaacaagtcgataaaatcgtagcagcgatggca
ttagcaggttcagaaaattctttagtattagctcatgcagcctatgatgaaactggtcga
ggtgttgttgaagataaagatacaaaaaatcgttttgcatcagaatctgtttataacgca
atcaagtttgataagacagttggtgtcatcagcgaagataaaattcaagggaaagttgaa
ttggctgcaccgttaggcgtcttggctggtatcgtgcccacaactaacccaacatcgaca
acgattttcaagtcaatgctaacagctaagacacgaaacacaatcatctttgcatttcat
ccacaagcacaaaaatcatcggcacttgctgccaaaattgtttatgatgcagctgttaaa
gctggtgcacctgaaaactttattcagtggattgaaaagccatcactttatggtactagt
gcgttaattcaaaatcatagcatagcatctattctagctactggtgggcctgcaatggtt
aatgcagccttgaagtcgggaaatccttcgatgggtgttggtgctggaaacggggctatt
tacctagatgcaacagttgatactgatcgtgcggtatctgatttgttattgtcaaagcgt
tttgataatggtatgatctgtgctactgagaattcagcagtcattcaagccccaatttat
gatgaagtgcttcaaaagatgcaggatcaaggtgcttatttagtacctaaaaaagactac
aaaaaaattgctgattatgtgtttaagccaaatgccgaaggctttggcattgctggtcca
gttgctggtatgtcaggccgttggattgctgaacaagctggtgtgaaaattcctgaaggc
aaagatgtcttactgtttgaattggatcaaaagaatattggtgaagctttgtcttcagaa
aagttgtcaccgttactttcaatttataaggttgaaaagcgcgaagaagctattaaaaca
gtacaatcattgctgaactatcaaggtgccggacacaatgctgctattcaaattggttca
caagatgatccatttattaaagaatatgcggatgcaattggtgcatcacgtatcttggtt
aaccaaccggattcaatcggtggtgttggcgatatctatacagatgctatgcggccatca
ttgacgcttggtaccggatcatgggggaagaattcattgtctcacaacttatcaacatat
gacttgcttaatattaaaacagtggctcgcagacgtaaccgaccacagtggattcgttta
cctaaagaagtctactatgaagcaaatgcaatcacttacctgcaagaattgccatcaatt
aagcgagcattcattgttgctgatcctggtatggttcagttcggatttgttggtaaagta
ttgagccaacttgaattacgtcaagaacaggtagaaacaaacatttatggttcagttaaa
cctgacccaaccttatcacaagccgttgatattgcccgccaaatggctgcatttaagcca
gatactgtcattttacttggtggtggttcagcgcttgatgcaggaaaaattgcgcgcttc
ttgtacgaatattcaacacgtcacgaaggcattttagaagacgaagacggtatcaaagag
ttgttcatggaattgcaacaaaaattcatggatattcgtaagcgtatcgttaagttctat
catgcgcgtttgacgcaaatggttgctattccaacaacatctggtactggttcagaagtg
acaccattcgcggtaataactgatgatcaaacacatgttaagtacccattggctgattat
gaattgacacccgaggtggcgattgtcgatccagagtttgttatgaccgtgccaaagcgc
acagtagcattctcaggcttagatgctttgtcacatgcatttgaatcatatgtgtcagtt
atggcatcagaatttacacgcccttgggctttacaagctatcaagttgatttttgacaat
ttgacaacatcgtaccaatacgatccaaaaaatccgacaaaagaaggccaaaatgcacgc
acaaagatgcactatgcctcaactttagctggtatgtcgtttgccaatgcgttcttagga
attaaccattcgctagcccacaaaactggtggtgaattcggtttgcctcatggcttggca
attgcaattgcaatgcctcatgtgatcaaatttaatgcggtgactggtaacgttaagcgt
accccttatccacgctatgaaacttacacagcgcaaaaagattatgcagatattgcccgt
taccttggattaaagggtaatacggatgctgagatggttgatgctttgattgctgctgta
aaaacgttagctaagtcggttgaagttgaccaaactttgacaggcaatggcgttaagaaa
gcggatttagaaagcaacattgatcagttgacagaccttgtttacaatgatcagtgcaca
ccaggtaatccacgccaacctagtttagaagaaatcaaacaattgttgagagatcaactt
taa

DBGET integrated database retrieval system