KEGG   Leuconostoc gasicomitatum: LEGAS_0220Help
Entry
LEGAS_0220        CDS       T01267                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LEGAS_0220 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_0220 (adhE)
   00620 Pyruvate metabolism
    LEGAS_0220 (adhE)
   00650 Butanoate metabolism
    LEGAS_0220 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LEGAS_0220 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LEGAS_0220 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LEGAS_0220 (adhE)
   00626 Naphthalene degradation
    LEGAS_0220 (adhE)
Enzymes [BR:lgs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LEGAS_0220 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LEGAS_0220 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210200..212902
Genome map
AA seq 900 aa AA seqDB search
MADTIVKKPVKKVLTPEEKAELQIQAEAMTAALVEKSKIALATFSTYTQKQVDKIVAAMA
LAGSENSLVLAHAAYDETGRGVVEDKDTKNRFASESVYNAIKFDKTVGVISEDKIQGKVE
LAAPLGVLAGIVPTTNPTSTTIFKSMLTAKTRNTIIFAFHPQAQKSSALAAKIVYDAAVK
AGAPENFIQWIEKPSLYGTSALIQNHSIASILATGGPAMVNAALKSGNPSMGVGAGNGAI
YLDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQAPIYDEVLQKMQDQGAYLVPKKDY
KKIADYVFKPNAEGFGIAGPVAGMSGRWIAEQAGVKIPEGKDVLLFELDQKNIGEALSSE
KLSPLLSIYKVEKREEAIKTVQSLLNYQGAGHNAAIQIGSQDDPFIKEYADAIGASRILV
NQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWIRL
PKEVYYEANAITYLQELPSIKRAFIVADPGMVQFGFVGKVLSQLELRQEQVETNIYGSVK
PDPTLSQAVDIARQMAAFKPDTVILLGGGSALDAGKIARFLYEYSTRHEGILEDEDGIKE
LFMELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDQTHVKYPLADY
ELTPEVAIVDPEFVMTVPKRTVAFSGLDALSHAFESYVSVMASEFTRPWALQAIKLIFDN
LTTSYQYDPKNPTKEGQNARTKMHYASTLAGMSFANAFLGINHSLAHKTGGEFGLPHGLA
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARYLGLKGNTDAEMVDALIAAV
KTLAKSVEVDQTLTGNGVKKADLESNIDQLTDLVYNDQCTPGNPRQPSLEEIKQLLRDQL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcagatacaattgtaaaaaagcccgtaaaaaaggttttgacacctgaagaaaaagca
gaactacaaatacaagctgaagcaatgacagcagcattagttgaaaaatcaaaaatagca
ttagcaacgttttcgacctatacacagaaacaagtcgataaaatcgtagcagcgatggca
ttagcaggttcagaaaattctttagtattagctcatgcagcctatgatgaaactggtcga
ggtgttgttgaagataaagatacaaaaaatcgttttgcatcagaatctgtttataacgca
atcaagtttgataagacagttggtgtcatcagcgaagataaaattcaagggaaagttgaa
ttggctgcaccgttaggcgtcttggctggtatcgtgcccacaactaacccaacatcgaca
acgattttcaagtcaatgctaacagctaagacacgaaacacaatcatctttgcatttcat
ccacaagcacaaaaatcatcggcacttgctgccaaaattgtttatgatgcagctgttaaa
gctggtgcacctgaaaactttattcagtggattgaaaagccatcactttatggtactagt
gcgttaattcaaaatcatagcatagcatctattctagctactggtgggcctgcaatggtt
aatgcagccttgaagtcgggaaatccttcgatgggtgttggtgctggaaacggggctatt
tacctagatgcaacagttgatactgatcgtgcggtatctgatttgttattgtcaaagcgt
tttgataatggtatgatctgtgctactgagaattcagcagtcattcaagccccaatttat
gatgaagtgcttcaaaagatgcaggatcaaggtgcttatttagtacctaaaaaagactac
aaaaaaattgctgattatgtgtttaagccaaatgccgaaggctttggcattgctggtcca
gttgctggtatgtcaggccgttggattgctgaacaagctggtgtgaaaattcctgaaggc
aaagatgtcttactgtttgaattggatcaaaagaatattggtgaagctttgtcttcagaa
aagttgtcaccgttactttcaatttataaggttgaaaagcgcgaagaagctattaaaaca
gtacaatcattgctgaactatcaaggtgccggacacaatgctgctattcaaattggttca
caagatgatccatttattaaagaatatgcggatgcaattggtgcatcacgtatcttggtt
aaccaaccggattcaatcggtggtgttggcgatatctatacagatgctatgcggccatca
ttgacgcttggtaccggatcatgggggaagaattcattgtctcacaacttatcaacatat
gacttgcttaatattaaaacagtggctcgcagacgtaaccgaccacagtggattcgttta
cctaaagaagtctactatgaagcaaatgcaatcacttacctgcaagaattgccatcaatt
aagcgagcattcattgttgctgatcctggtatggttcagttcggatttgttggtaaagta
ttgagccaacttgaattacgtcaagaacaggtagaaacaaacatttatggttcagttaaa
cctgacccaaccttatcacaagccgttgatattgcccgccaaatggctgcatttaagcca
gatactgtcattttacttggtggtggttcagcgcttgatgcaggaaaaattgcgcgcttc
ttgtacgaatattcaacacgtcacgaaggcattttagaagacgaagacggtatcaaagag
ttgttcatggaattgcaacaaaaattcatggatattcgtaagcgtatcgttaagttctat
catgcgcgtttgacgcaaatggttgctattccaacaacatctggtactggttcagaagtg
acaccattcgcggtaataactgatgatcaaacacatgttaagtacccattggctgattat
gaattgacacccgaggtggcgattgtcgatccagagtttgttatgaccgtgccaaagcgc
acagtagcattctcaggcttagatgctttgtcacatgcatttgaatcatatgtgtcagtt
atggcatcagaatttacacgcccttgggctttacaagctatcaagttgatttttgacaat
ttgacaacatcgtaccaatacgatccaaaaaatccgacaaaagaaggccaaaatgcacgc
acaaagatgcactatgcctcaactttagctggtatgtcgtttgccaatgcgttcttagga
attaaccattcgctagcccacaaaactggtggtgaattcggtttgcctcatggcttggca
attgcaattgcaatgcctcatgtgatcaaatttaatgcggtgactggtaacgttaagcgt
accccttatccacgctatgaaacttacacagcgcaaaaagattatgcagatattgcccgt
taccttggattaaagggtaatacggatgctgagatggttgatgctttgattgctgctgta
aaaacgttagctaagtcggttgaagttgaccaaactttgacaggcaatggcgttaagaaa
gcggatttagaaagcaacattgatcagttgacagaccttgtttacaatgatcagtgcaca
ccaggtaatccacgccaacctagtttagaagaaatcaaacaattgttgagagatcaactt
taa

DBGET integrated database retrieval system