KEGG   Leuconostoc gasicomitatum: LEGAS_0286Help
Entry
LEGAS_0286        CDS       T01267                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LEGAS_0286 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_0286 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    LEGAS_0286 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LEGAS_0286 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LEGAS_0286 (adhA)
   00626 Naphthalene degradation
    LEGAS_0286 (adhA)
Enzymes [BR:lgs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LEGAS_0286 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
289056..290111
Genome map
AA seq 351 aa AA seqDB search
MKAAVVRETPNGYVDLIDDWTPRPLTFGEALVDMEYVGLCHTDLHVAGADFGNPNEIGQR
NGQFRRVIGHEGVGRVSKLAEGAGDYLKIGDRVSVAWFYDACGVCDYCVSGNETFCRKVR
NSGYTVDGAMSQQTVVNAKYAVKVPEGLDPVEATSITCAGVTMYKSLKVGETKPGQWVSV
HGAGGLGNLAVQYAHNVFGAHVAVIDGNDDKLAAAKANGAEVLINRKKVADVAAEVQKAT
GGVHNAQVTAVNAAAFDQAVSSLRPMGKLVAVALPQGDMALNIAKTVLDGIEVRGSLVGT
RADLKEAFQFGAEGKVKPIVEKVNFNDMNEVIDEMKAGSITGRKVFDLTAL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagttgtacgtgaaacaccaaatggatacgttgatttaattgatgattgg
acaccaaggccattaacatttggtgaagctttagtagatatggaatatgttggtttgtgc
cacacagacttgcatgttgccggtgctgattttggcaatccaaatgaaataggtcaacga
aatggtcagttccgtcgtgttattggtcatgaaggtgttggacgtgtatcaaagcttgcg
gaaggtgcgggcgattacttgaaaattggtgatcgtgtgtcagttgcttggttctatgac
gcttgtggtgtatgcgattattgtgtttcagggaatgaaacattttgccgtaaagtccgt
aactcaggttatacagttgatggtgcaatgtcacaacagactgttgtcaatgcaaagtat
gctgttaaagtaccagaaggattagatccagttgaagccacatcaattacgtgtgcaggt
gtgactatgtataagtcacttaaagttggtgaaacaaagcctggacaatgggtttccgtt
catggtgctggtggtttaggcaatctagctgtgcagtatgctcataatgttttcggtgca
catgttgctgttattgatggcaatgatgacaagcttgctgctgccaaggcaaacggtgct
gaggttttgattaatcgtaagaaagtagccgatgttgctgctgaagtgcaaaaggcaaca
ggtggtgttcataacgcacaagtaacggccgttaatgcagcagcatttgaccaagctgtc
agctcattacgcccaatgggtaaattggtcgcagttgccttaccacaaggtgatatggct
ctaaacattgcaaaaactgtattagatggtatcgaagtccgtggttcattggttggtaca
cgtgcagatttgaaggaagcctttcaatttggtgccgaaggtaaagttaagcccattgta
gaaaaagttaactttaacgatatgaacgaagtaattgatgagatgaaagccggaagtatt
acaggtcgtaaagtatttgatttaacagcactataa

DBGET integrated database retrieval system