KEGG   Leuconostoc gasicomitatum: LEGAS_0365Help
Entry
LEGAS_0365        CDS       T01267                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lgs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368829..369434
Genome map
AA seq 201 aa AA seqDB search
MDYPEPIAKLIDSYTKLPGIGSKTATRLAFYTLGMDEKDVLDFSKSLVSAKKDLTFCSVC
GNITENSINPCVICRDVTRDQDTVFVVENSRDVMAMENTRDYHGLYHVLNGVISPSAGTG
PEDINLPSLIRRLSEHQEIDEVIVGTNVTAEGEATAMYLARLLKPAGIKVTRLAHGLAVG
SDIDYADQLTLIKAVQGRTEL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggattatccagaacctattgcaaaattaatagatagttatacaaaattacccggtatt
ggttctaaaactgccacacgcttggctttttatacgcttggcatggacgaaaaagatgta
ttagatttttcaaaatcacttgtttctgccaaaaaagatctgacattttgttcggtatgt
ggtaatataacggaaaatagtattaacccttgtgtgatatgtcgagatgtcacgcgtgat
caagatactgtgtttgttgtcgaaaattctcgtgatgtcatggctatggaaaacacgagg
gactatcatgggctttatcatgttttgaatggtgtaatttcacccagtgcgggaacaggg
ccagaagatattaatttgcctagtttaattcgacgcttatcagaacatcaagaaattgat
gaggttattgttggtaccaatgttactgctgaaggggaagcaacagccatgtatcttgca
aggttactcaaacctgcagggatcaaggtgacacgtttagcacatggtttggcagttggg
tcagatattgattatgcagatcagttaacactgattaaagccgtacaaggacgaacagaa
ttatga

DBGET integrated database retrieval system