KEGG   Leuconostoc gasicomitatum: LEGAS_0460Help
Entry
LEGAS_0460        CDS       T01267                                 

Gene name
tpiA2
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lgs01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lgs01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lgs00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lgs00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:lgs00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
463703..464428
Genome map
AA seq 241 aa AA seqDB search
MICIVNFKNMMHYEKQLKWLQDIEREFLDFKLLVAPTLPEHNRYHNYEIVAQNISLVQRT
VGEVSASVLNGLKIQYAFVGHLERRRLLNETTDMINERLINCLHNHIVPIICLGIHSGPD
LVIRELKSILKNSDLSDQRVIIAYESLKSTQSNQPVYSYVEMEAVYLKLKQYMDELTNSS
GLSAYHLVMGGHINEEGINVAEKIGYDGVLIGDRYQEVTSFQPLIKTLNRIKRERLLTHG
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtattgttaattttaaaaatatgatgcattatgaaaaacagttaaaatggtta
caagatattgagcgtgaatttcttgattttaaattattagttgcacccacgctaccagaa
cacaataggtatcacaattatgaaattgttgcgcaaaacattagtttagtgcaacgtaca
gtgggggaagtctctgctagcgtattgaatggattaaagattcaatatgcttttgtaggt
catttagagcgcagaagactgctaaatgaaacaacagatatgattaatgaacgcttaatc
aattgtcttcacaatcatattgtgccaattatatgtttaggaattcatagtgggccggat
ttagttatccgtgaattaaaatctattttaaaaaatagtgatttgagtgaccaacgcgtg
attatagcttatgaatctttgaaatcaacacagtccaatcaacctgtctattcctatgta
gagatggaggcagtatatctgaaattaaaacaatatatggatgaactaactaatagtagc
ggattatcagcatatcatttagtgatgggcggacatatcaacgaagagggcattaatgtg
gctgaaaaaatcggatatgatggcgtgttaattggtgatcgttatcaagaagtgacgtca
tttcaaccgctgatcaaaacattaaatcgaatcaaaagagaaagattattgactcatgga
agctga

DBGET integrated database retrieval system