KEGG   Leuconostoc gasicomitatum: LEGAS_0460Help
Entry
LEGAS_0460        CDS       T01267                                 

Gene name
tpiA2
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEGAS_0460 (tpiA2)
   01230 Biosynthesis of amino acids
    LEGAS_0460 (tpiA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_0460 (tpiA2)
   00051 Fructose and mannose metabolism
    LEGAS_0460 (tpiA2)
   00562 Inositol phosphate metabolism
    LEGAS_0460 (tpiA2)
Enzymes [BR:lgs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LEGAS_0460 (tpiA2)
Exosome [BR:lgs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LEGAS_0460 (tpiA2)
  Exosomal proteins of bladder cancer cells
   LEGAS_0460 (tpiA2)
  Exosomal proteins of melanoma cells
   LEGAS_0460 (tpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
463703..464428
Genome map
AA seq 241 aa AA seqDB search
MICIVNFKNMMHYEKQLKWLQDIEREFLDFKLLVAPTLPEHNRYHNYEIVAQNISLVQRT
VGEVSASVLNGLKIQYAFVGHLERRRLLNETTDMINERLINCLHNHIVPIICLGIHSGPD
LVIRELKSILKNSDLSDQRVIIAYESLKSTQSNQPVYSYVEMEAVYLKLKQYMDELTNSS
GLSAYHLVMGGHINEEGINVAEKIGYDGVLIGDRYQEVTSFQPLIKTLNRIKRERLLTHG
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtattgttaattttaaaaatatgatgcattatgaaaaacagttaaaatggtta
caagatattgagcgtgaatttcttgattttaaattattagttgcacccacgctaccagaa
cacaataggtatcacaattatgaaattgttgcgcaaaacattagtttagtgcaacgtaca
gtgggggaagtctctgctagcgtattgaatggattaaagattcaatatgcttttgtaggt
catttagagcgcagaagactgctaaatgaaacaacagatatgattaatgaacgcttaatc
aattgtcttcacaatcatattgtgccaattatatgtttaggaattcatagtgggccggat
ttagttatccgtgaattaaaatctattttaaaaaatagtgatttgagtgaccaacgcgtg
attatagcttatgaatctttgaaatcaacacagtccaatcaacctgtctattcctatgta
gagatggaggcagtatatctgaaattaaaacaatatatggatgaactaactaatagtagc
ggattatcagcatatcatttagtgatgggcggacatatcaacgaagagggcattaatgtg
gctgaaaaaatcggatatgatggcgtgttaattggtgatcgttatcaagaagtgacgtca
tttcaaccgctgatcaaaacattaaatcgaatcaaaagagaaagattattgactcatgga
agctga

DBGET integrated database retrieval system