KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_0460Help
Entry
LEGAS_0460        CDS       T01267                                 

Gene name
tpiA2
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00010  Glycolysis / Gluconeogenesis
lgs00051  Fructose and mannose metabolism
lgs00562  Inositol phosphate metabolism
lgs01100  Metabolic pathways
lgs01110  Biosynthesis of secondary metabolites
lgs01120  Microbial metabolism in diverse environments
lgs01130  Biosynthesis of antibiotics
lgs01200  Carbon metabolism
lgs01230  Biosynthesis of amino acids
Module
lgs_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_0460 (tpiA2)
   00051 Fructose and mannose metabolism
    LEGAS_0460 (tpiA2)
   00562 Inositol phosphate metabolism
    LEGAS_0460 (tpiA2)
Enzymes [BR:lgs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LEGAS_0460 (tpiA2)
Exosome [BR:lgs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LEGAS_0460 (tpiA2)
  Exosomal proteins of bladder cancer cells
   LEGAS_0460 (tpiA2)
  Exosomal proteins of melanoma cells
   LEGAS_0460 (tpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PgaPase_1
Motif
Other DBs
NCBI-ProteinID: CBL91108
Position
463703..464428
Genome map
AA seq 241 aa AA seqDB search
MICIVNFKNMMHYEKQLKWLQDIEREFLDFKLLVAPTLPEHNRYHNYEIVAQNISLVQRT
VGEVSASVLNGLKIQYAFVGHLERRRLLNETTDMINERLINCLHNHIVPIICLGIHSGPD
LVIRELKSILKNSDLSDQRVIIAYESLKSTQSNQPVYSYVEMEAVYLKLKQYMDELTNSS
GLSAYHLVMGGHINEEGINVAEKIGYDGVLIGDRYQEVTSFQPLIKTLNRIKRERLLTHG
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtattgttaattttaaaaatatgatgcattatgaaaaacagttaaaatggtta
caagatattgagcgtgaatttcttgattttaaattattagttgcacccacgctaccagaa
cacaataggtatcacaattatgaaattgttgcgcaaaacattagtttagtgcaacgtaca
gtgggggaagtctctgctagcgtattgaatggattaaagattcaatatgcttttgtaggt
catttagagcgcagaagactgctaaatgaaacaacagatatgattaatgaacgcttaatc
aattgtcttcacaatcatattgtgccaattatatgtttaggaattcatagtgggccggat
ttagttatccgtgaattaaaatctattttaaaaaatagtgatttgagtgaccaacgcgtg
attatagcttatgaatctttgaaatcaacacagtccaatcaacctgtctattcctatgta
gagatggaggcagtatatctgaaattaaaacaatatatggatgaactaactaatagtagc
ggattatcagcatatcatttagtgatgggcggacatatcaacgaagagggcattaatgtg
gctgaaaaaatcggatatgatggcgtgttaattggtgatcgttatcaagaagtgacgtca
tttcaaccgctgatcaaaacattaaatcgaatcaaaagagaaagattattgactcatgga
agctga

DBGET integrated database retrieval system