KEGG   Leuconostoc gasicomitatum: LEGAS_0560Help
Entry
LEGAS_0560        CDS       T01267                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_0560 (galM)
   00052 Galactose metabolism
    LEGAS_0560 (galM)
Enzymes [BR:lgs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LEGAS_0560 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
579388..580425
Genome map
AA seq 345 aa AA seqDB search
MNIIESAFGDHAKLFTMVNDNGVQLAVTDFGARIVHLNVPINNERRELILGFDSAEEYIA
KDHYIGATIGRVAGRIANGSFQLNQTNYQVVKNENDNTLHGGPDSFEMAYWQSETDISDN
KVSTSFTHTSPNQNNGFPGNLTVKVTYTLDNDNVWQVSYEANSDAMTLFNPTNHVYFNLT
GHPGMSVADHMLSIDADHFAPLDDQNLTTGEQRDVAQTAFDFRKAKKVNEALISADPQNQ
LVSGLDHPFLLNQATDSASPQARLVSPDQKVAINMRTTAPSVVVFTANFGDDYQLPMRQE
QLINHGGITLETQVAPGAEKYPAFGNIVLPANEVYQATTRFDIDI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaatattattgaaagtgcgtttggcgatcatgctaaactttttacaatggttaatgat
aatggtgtgcagctagctgtgacagattttggtgcacgtattgtgcacttgaatgtgcca
attaacaatgagcgaagagaattgattttaggctttgactccgctgaggaatatattgcc
aaagatcattatatcggtgcaacaattggtagagtcgccgggcgtattgccaacggttcg
tttcaacttaatcagacaaactatcaagttgtaaaaaatgaaaatgataacacgctgcat
ggtggaccagatagtttcgagatggcatactggcagagtgaaacggacataagtgacaat
aaagtatcaacatcatttacgcacactagtcctaatcagaacaatggatttccgggaaat
ttgaccgtcaaagtgacttatacacttgataatgataacgtttggcaagtcagttatgaa
gcaaacagtgatgctatgacactatttaatccaacaaaccatgtttatttcaacttgaca
ggacatcccggtatgagtgttgctgatcatatgttgtctattgatgcagatcattttgca
cctcttgatgaccagaacctgacaactggcgaacaacgtgatgtagcccagacggctttc
gattttagaaaagcaaagaaagttaatgaagcactgatttctgccgatcctcagaatcaa
ttagttagtggtcttgatcatccatttttattgaatcaagcaaccgactctgctagccct
caggctcgtttggtatcgccagatcaaaaagtagctattaatatgcgaacaacagcgcca
tcagtggttgtctttacagccaactttggggatgactatcaattgcctatgcgtcaagag
caattgattaatcatggtggtataacacttgaaacacaagtagcacctggtgcagaaaaa
tatccagcgtttggtaatatcgtcctacctgcaaatgaagtttatcaggcaacaacgcgt
tttgacatagatatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system