KEGG   Leuconostoc gasicomitatum: LEGAS_0661Help
Entry
LEGAS_0661        CDS       T01267                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LEGAS_0661 (galU)
   00052 Galactose metabolism
    LEGAS_0661 (galU)
   00500 Starch and sucrose metabolism
    LEGAS_0661 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LEGAS_0661 (galU)
Enzymes [BR:lgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LEGAS_0661 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677147..678019
Genome map
AA seq 290 aa AA seqDB search
MKPVRKAIIPAAGLGTRFLPATKALAKEMLPIVDTPTIEYIVREAIASGIEDIVIVDGKS
KRSIEDHFDSNPELENNLRDKGKDELLKIVQETTDINMYFIRQSHPKGLGDAVLTAKAFI
GDEPFVVLLGDDLMEDDVPLTKQLIQRYEETGESTLAVMKVPHDQVSEYGVIDPAAEASD
GLYRVKSFVEKPKPEDAPSDLAIIGRYLLTPEIFEELENTQPGKGNEIQLTDAIDSLNNR
QHVYAHEFKGSRYDIGSKIGFLETNIEFGLKHPQTKDQLRAYIKELAAKL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtacgtaaagcaattataccagcagcaggattaggaacacggtttttgccg
gctacaaaagcattagctaaagaaatgttaccaattgttgatacaccaacaatagaatat
attgtgcgcgaggcaattgcttcaggaattgaagacattgtgattgttgacggtaaatca
aaacgttcaattgaagatcattttgattcaaatcccgaactagaaaataatttacgtgac
aaagggaaagatgaactactaaaaattgtacaagaaacaactgacattaatatgtacttt
attcgtcagtctcatcctaagggactcggagatgctgtgttgacagcaaaagcttttatt
ggggatgaaccctttgttgtcctacttggtgatgatttaatggaagatgatgtaccatta
acgaaacagttaatccaacgttatgaagagacgggagaatcaactttagcggtgatgaaa
gtaccgcatgatcaagtctctgagtatggcgtgatcgatcctgcagcagaagcctctgat
ggcctatatcgtgttaaatcctttgttgaaaaaccaaagccagaagatgcaccatcagac
ttggctattattggtcgatatctattgacaccagaaatttttgaagaattagaaaacaca
caaccgggtaagggaaacgaaattcaattaacggatgctatcgattcattaaataatcgt
caacatgtctatgcgcatgaatttaagggtagtcgttatgatattggatcaaaaattggt
tttttggaaacaaacattgaatttggtctgaaacacccacaaacaaaagatcagttacgt
gcatatattaaagaactagcagccaagctgtga

DBGET integrated database retrieval system