KEGG   Leuconostoc gasicomitatum: LEGAS_0665Help
Entry
LEGAS_0665        CDS       T01267                                 

Gene name
gftA
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LEGAS_0665 (gftA)
Enzymes [BR:lgs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LEGAS_0665 (gftA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680675..682126
Genome map
AA seq 483 aa AA seqDB search
MKKLTNEAMLITYADSLGKNLKELNQVLSNELNGVVGGVHVLPFFPSTGDRGFAPEQYET
VDPKFGDWSDVDKLADKYYLMFDFMLNHISPQSKYFQDFLEKKEASEYYDMFLKYSDFWP
ENRPTDADIDLIYKRKDKAPFAPVTFADGTTDQVWNTFGDQQMDLDVTKEVTKKFIKDSL
VNLAHHGASVIRLDAFAYAIKKLDTNDFFVEPEIWAILDEVREILAAEGSEVLPEIHEHY
KIVRKITEHDMYSYDFALPLITLYSLYSGKTERIADWLRQSPMKQFTTLDTHDGIGVVDA
KDLLTQEETDFTTEEMYKVGANVKKIFSSAAYNNLDIYQINTTYYSALGNDDAAYLLARA
AQIFAPGIPQIYYVGLLAGENDIELLENSKEGRNINRHYYDLAEIAETTKRPVVSNLFDL
LRFRNTSAAFDLDGSIDVVNDGENELTVSRTSADGKTTAVLDANFATKSFTVTENGKEIF
TTK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactaacaaatgaagcgatgttgattacatacgctgattcacttggaaaaaac
ttgaaagaattgaatcaagtactatctaatgaacttaatggtgttgtaggcggcgtgcat
gtcctaccatttttcccatcaacaggggatcgtggttttgcgcctgaacagtatgagaca
gttgatcctaaatttggtgattggtcagatgttgataagttggcagacaaatactacttg
atgtttgactttatgttgaatcatatttcacctcaatcaaagtatttccaagattttttg
gaaaagaaagaggcgtcagaatattatgatatgttcctgaagtattctgatttttggcca
gaaaatcgaccaacagatgccgatattgatttgatatataagcgtaaggataaagcacca
tttgcgcctgttacctttgctgatggcacaactgaccaagtttggaacacatttggtgat
caacaaatggatttggatgttacaaaagaagtaacaaaaaaattcattaaagattcactt
gttaatttggcacatcatggtgcatcagttattcgtttagatgcctttgcttatgcaatt
aagaagctagatacaaatgactttttcgttgaacctgaaatttgggctattttagatgaa
gttcgtgaaatattggcagcagaaggatcagaagtattacctgaaatccatgaacattac
aaaattgtacgtaagattactgaacatgacatgtattcatacgattttgcattgccactg
attacattatattcattatactcaggtaagacagaacgaattgcggattggctgcgtcaa
agtccaatgaaacaattcacaacattggatacacatgatggtattggtgttgttgatgct
aaggatttgttgacacaagaagaaactgacttcacaactgaagaaatgtataaagttggt
gccaatgtcaaaaagattttctcttcagcggcatataataatttggacatctatcaaata
aacacaacttattattcagcattaggtaatgatgatgctgcctacttattggctcgtgca
gcacaaatatttgcacctggtattccacaaatttattacgttggtttgcttgctggtgaa
aatgatattgaacttttggaaaattcaaaagaaggtcgtaacattaaccgtcattattat
gacttggctgaaattgctgaaacaacaaagcgaccagttgtttcaaacttgtttgactta
ttacgtttccgtaatacaagtgcagcctttgatttagatggttcaattgatgtagttaat
gatggcgaaaatgaattgacagtatcacgtacatctgcagatggcaaaacaactgctgtt
ttggatgctaactttgcaacaaagagctttactgtaactgaaaatggtaaagaaatattt
acgacaaagtaa

DBGET integrated database retrieval system