KEGG   Leuconostoc gasicomitatum: LEGAS_0732Help
Entry
LEGAS_0732        CDS       T01267                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lgs01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lgs00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
750901..752145
Genome map
AA seq 414 aa AA seqDB search
MDNDELVLQDLVRINTAGKNEVAIARYLKKLFDEHDITNEIIGFDDGRAGLIAEIGNGHG
PILAFDGHEDTVALGDKTRWQTDPLSGIKIDDKIFGRGITDMKSGLAAGVLAMIRLKRNE
HLLNGTFKLYATVGEETGELGAKQMVEAGLANQIDALLIGEPSGIQLDYIKSLPAAQSLP
GIVMAENIHDISEKNKTAEQHFLEIAHKGAISYRITSQGITAHSSMPELGVNAIDALLTF
YNKQQELFNDISKIQNKLLGKTTPVVTQIAGGEQPNTVPGSATMGVFVRTIPEVPHEKIV
SEVEKIINEINASGKAELSLTINFENQPVYSNPNGRLSQITKEIGEKLIHQSLPFIGVSG
GTDASQFIKANPNMEVVIFGPGNITAHQVDEFVDAGMYHSFIDIYESVVRQYLK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggataatgatgaattagttttgcaggatctcgttcgaattaatactgctggaaaaaat
gaagtggcgattgctagatatttaaaaaagttatttgatgagcatgatattaccaatgaa
ataattggatttgacgatggacgagcaggtcttattgctgaaattgggaatggacatggt
ccaattttggcttttgatgggcatgaagatacagttgctttgggggataagacgcgttgg
caaacagacccattaagtggcattaaaattgacgataaaatatttggcagaggaatcact
gacatgaaatcaggcttagcagctggtgtgttagcgatgattcggttaaagagaaacgag
catttattaaatggtacgtttaaattatatgcaactgttggtgaagaaactggtgaacta
ggtgccaagcaaatggttgaagctggattggccaatcagattgatgcattattaattggt
gaacccagtggcatacagctggactatattaaatcactaccggcagcacaatcgttgcct
ggcattgtcatggcagaaaacatacatgatatcagtgagaagaacaaaacagctgagcaa
cattttttagaaattgcacacaaaggtgcaatttcttatcgtattacgagtcaaggtatt
acggcacatagttcaatgcctgaacttggcgtcaatgccattgacgctttgttaacattt
tataataagcaacaagaactatttaacgatatctctaaaattcaaaacaaattactgggc
aaaacgacaccggttgtgacacaaatagctggtggagaacaacccaataccgtacctggt
agtgcaacaatgggtgtctttgtgaggacaattccagaggtaccccatgaaaaaatagta
tcagaagttgaaaaaatcattaacgagataaatgctagtggaaaagctgagctgagtttg
acgattaattttgaaaatcagcctgtttactctaatccgaatggtagattaagtcaaatc
acaaaggaaattggcgaaaagctaatacaccaatcattaccctttattggtgtttctggt
ggtactgatgcttcacagtttattaaggctaatccaaatatggaagttgttatttttgga
ccaggaaacattacagcacaccaagttgatgaattcgttgatgccggtatgtatcactca
tttatagatatttatgaatcagttgtacgtcaatatttgaaataa

DBGET integrated database retrieval system