KEGG   Leuconostoc gasicomitatum: LEGAS_0754Help
Entry
LEGAS_0754        CDS       T01267                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEGAS_0754 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_0754 (glcK)
   00052 Galactose metabolism
    LEGAS_0754 (glcK)
   00500 Starch and sucrose metabolism
    LEGAS_0754 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LEGAS_0754 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LEGAS_0754 (glcK)
   00524 Butirosin and neomycin biosynthesis
    LEGAS_0754 (glcK)
Enzymes [BR:lgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LEGAS_0754 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
775485..776453
Genome map
AA seq 322 aa AA seqDB search
MAKDKLIGVDLGGTTIKFAILTETGEIQQKWSIKTNVFDDGVHIVPDIIESINHHLDLYQ
LDPKRVIGIGMGTPGTVNRTTGTVTGAYNLNWKTEQNVKADIESGTGFLLTLDNDANAAA
LGEAWRGAGNNDDEVSFITLGTGVGGGLVSNGQLIHGTAGAGGEIGHVVVEPNGYLCTCG
NKGCLEQYTSATGVVHLAQDFSEEYVGSSKLKQLIANGDEVTSKIVFDLAKDGDFLANKV
IDKVAYYLGYATAAMSNILNPSAVVIGGGVAAAGEFLRARVEKNWQTFAFPTVRSTTRVK
LAELGNDAGVIGAASLARVDTN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagataaattaatcggtgttgaccttggtggcacaacaattaagtttgctatt
ttaactgaaactggtgaaattcaacaaaaatggtcaattaaaacgaatgtttttgatgat
ggagtacatattgtaccagatattattgaatcaattaatcaccaccttgacttatatcaa
ttagatccaaagcgtgtgattgggattggcatgggtacacctggaacggtaaaccggacg
actggtaccgtgactggtgcttataacttaaattggaagacagaacaaaatgttaaagca
gacattgaatctggtactggctttttgttgacgctggacaatgacgctaacgctgcagca
cttggtgaggcttggagaggtgctggtaataatgatgatgaggtatcatttattacactt
ggtaccggtgttggtggtggtttagtctccaatggtcaactgattcatggaactgccggt
gcaggtggtgaaattgggcatgttgttgttgaacccaacggttacttatgtacttgtggg
aacaaaggttgcttggaacaatatacttcggcgaccggtgttgtacacttagcacaagat
ttttctgaagagtatgttggttcatcaaagctaaaacaattaattgctaatggggatgaa
gtcacttcaaaaattgtgtttgatttagcaaaagatggtgattttttggctaataaagtt
attgataaagtggcatattacttaggctatgctacagcagctatgtctaacatattaaat
ccatcagctgttgttattggtggtggtgtggccgcagcgggagagtttttacgtgcccgt
gtagaaaaaaattggcaaacatttgcttttccaacagttagaagtacaacacgtgttaaa
ttagccgaactaggtaatgatgctggcgtcattggcgcagcatcattggcacgtgttgac
actaactaa

DBGET integrated database retrieval system