KEGG   Leuconostoc gasicomitatum: LEGAS_0754Help
Entry
LEGAS_0754        CDS       T01267                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:lgs01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lgs00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lgs00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lgs00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lgs00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lgs00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
775485..776453
Genome map
AA seq 322 aa AA seqDB search
MAKDKLIGVDLGGTTIKFAILTETGEIQQKWSIKTNVFDDGVHIVPDIIESINHHLDLYQ
LDPKRVIGIGMGTPGTVNRTTGTVTGAYNLNWKTEQNVKADIESGTGFLLTLDNDANAAA
LGEAWRGAGNNDDEVSFITLGTGVGGGLVSNGQLIHGTAGAGGEIGHVVVEPNGYLCTCG
NKGCLEQYTSATGVVHLAQDFSEEYVGSSKLKQLIANGDEVTSKIVFDLAKDGDFLANKV
IDKVAYYLGYATAAMSNILNPSAVVIGGGVAAAGEFLRARVEKNWQTFAFPTVRSTTRVK
LAELGNDAGVIGAASLARVDTN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagataaattaatcggtgttgaccttggtggcacaacaattaagtttgctatt
ttaactgaaactggtgaaattcaacaaaaatggtcaattaaaacgaatgtttttgatgat
ggagtacatattgtaccagatattattgaatcaattaatcaccaccttgacttatatcaa
ttagatccaaagcgtgtgattgggattggcatgggtacacctggaacggtaaaccggacg
actggtaccgtgactggtgcttataacttaaattggaagacagaacaaaatgttaaagca
gacattgaatctggtactggctttttgttgacgctggacaatgacgctaacgctgcagca
cttggtgaggcttggagaggtgctggtaataatgatgatgaggtatcatttattacactt
ggtaccggtgttggtggtggtttagtctccaatggtcaactgattcatggaactgccggt
gcaggtggtgaaattgggcatgttgttgttgaacccaacggttacttatgtacttgtggg
aacaaaggttgcttggaacaatatacttcggcgaccggtgttgtacacttagcacaagat
ttttctgaagagtatgttggttcatcaaagctaaaacaattaattgctaatggggatgaa
gtcacttcaaaaattgtgtttgatttagcaaaagatggtgattttttggctaataaagtt
attgataaagtggcatattacttaggctatgctacagcagctatgtctaacatattaaat
ccatcagctgttgttattggtggtggtgtggccgcagcgggagagtttttacgtgcccgt
gtagaaaaaaattggcaaacatttgcttttccaacagttagaagtacaacacgtgttaaa
ttagccgaactaggtaatgatgctggcgtcattggcgcagcatcattggcacgtgttgac
actaactaa

DBGET integrated database retrieval system