KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_0754Help
Entry
LEGAS_0754        CDS       T01267                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00010  Glycolysis / Gluconeogenesis
lgs00052  Galactose metabolism
lgs00500  Starch and sucrose metabolism
lgs00520  Amino sugar and nucleotide sugar metabolism
lgs00521  Streptomycin biosynthesis
lgs01100  Metabolic pathways
lgs01110  Biosynthesis of secondary metabolites
lgs01120  Microbial metabolism in diverse environments
lgs01130  Biosynthesis of antibiotics
lgs01200  Carbon metabolism
Module
lgs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_0754 (glcK)
   00052 Galactose metabolism
    LEGAS_0754 (glcK)
   00500 Starch and sucrose metabolism
    LEGAS_0754 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LEGAS_0754 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LEGAS_0754 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LEGAS_0754 (glcK)
Enzymes [BR:lgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LEGAS_0754 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: CBL91402
Position
775485..776453
Genome map
AA seq 322 aa AA seqDB search
MAKDKLIGVDLGGTTIKFAILTETGEIQQKWSIKTNVFDDGVHIVPDIIESINHHLDLYQ
LDPKRVIGIGMGTPGTVNRTTGTVTGAYNLNWKTEQNVKADIESGTGFLLTLDNDANAAA
LGEAWRGAGNNDDEVSFITLGTGVGGGLVSNGQLIHGTAGAGGEIGHVVVEPNGYLCTCG
NKGCLEQYTSATGVVHLAQDFSEEYVGSSKLKQLIANGDEVTSKIVFDLAKDGDFLANKV
IDKVAYYLGYATAAMSNILNPSAVVIGGGVAAAGEFLRARVEKNWQTFAFPTVRSTTRVK
LAELGNDAGVIGAASLARVDTN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagataaattaatcggtgttgaccttggtggcacaacaattaagtttgctatt
ttaactgaaactggtgaaattcaacaaaaatggtcaattaaaacgaatgtttttgatgat
ggagtacatattgtaccagatattattgaatcaattaatcaccaccttgacttatatcaa
ttagatccaaagcgtgtgattgggattggcatgggtacacctggaacggtaaaccggacg
actggtaccgtgactggtgcttataacttaaattggaagacagaacaaaatgttaaagca
gacattgaatctggtactggctttttgttgacgctggacaatgacgctaacgctgcagca
cttggtgaggcttggagaggtgctggtaataatgatgatgaggtatcatttattacactt
ggtaccggtgttggtggtggtttagtctccaatggtcaactgattcatggaactgccggt
gcaggtggtgaaattgggcatgttgttgttgaacccaacggttacttatgtacttgtggg
aacaaaggttgcttggaacaatatacttcggcgaccggtgttgtacacttagcacaagat
ttttctgaagagtatgttggttcatcaaagctaaaacaattaattgctaatggggatgaa
gtcacttcaaaaattgtgtttgatttagcaaaagatggtgattttttggctaataaagtt
attgataaagtggcatattacttaggctatgctacagcagctatgtctaacatattaaat
ccatcagctgttgttattggtggtggtgtggccgcagcgggagagtttttacgtgcccgt
gtagaaaaaaattggcaaacatttgcttttccaacagttagaagtacaacacgtgttaaa
ttagccgaactaggtaatgatgctggcgtcattggcgcagcatcattggcacgtgttgac
actaactaa

DBGET integrated database retrieval system