KEGG   Leuconostoc gasicomitatum: LEGAS_0858Help
Entry
LEGAS_0858        CDS       T01267                                 

Gene name
murE1
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lgs00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lgs00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875844..877319
Genome map
AA seq 491 aa AA seqDB search
MKLTSKTIEQLLIEQQLLVSKPNIDLAFDFLHYDTRQVKANTLLVVKGAFRPEYLTHTAD
IEGLITETILDVSLPQWQVTNVQKALAVLSMAFFDYPQKALWIGAFTGTKGKTTAAYMAF
NILKDATNNHTALFSTVDRITGTGPGDKKKSDLTTPESYELFKDMRQAVDNGMTHLIMEV
SSQAYLKQRVYGLRYNVGAFLNISPDHIGPNEHPTFEDYLAHKMMLFDHSDQVIVNAESE
HLKTVLGHATQTHDKVYTYSLAGQGGNYSYVSRESAIHESRLIVEPSDLNELAGEYRLNL
PGDFNESNAMAALIMTALAGAKHENMVHGLDVVFIPGRMLSLPIVGHGVAFVDYAHNYAS
MRALLNFAQNQYPEGKVLVVVGSPGNKGVSRRADFGRVVSELADIVYLTADDPQFESPKA
IADEIAENINNKQLEVHFEMDRIKAIFQAIKQSGERDIVIVAGKGEDPYQKINGKDVPYI
GDYAVVQSYHD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttacaagcaaaacaattgaacaattattaattgaacaacagctattggtatca
aaaccaaatatagatttggcatttgattttttacattatgatacgcggcaggtgaaagcc
aacacgttacttgttgttaaaggcgccttccgacctgagtatttgacgcatacagctgat
atagaaggcttgattactgagacaatattagatgtttctttaccgcagtggcaagtgaca
aatgttcaaaaagcactagctgttttgtcaatggctttttttgattatccgcaaaaagcc
ttgtggattggcgcttttacaggaacaaaaggtaaaacaacagctgcatatatggcattt
aatatcttaaaagatgctacaaacaatcatacagctttgttttcaactgttgatcgtatt
acaggtacaggacctggagacaagaaaaaatcggatttaacaacaccggaatcctacgaa
ttatttaaagatatgcgtcaagcagtagacaatggtatgacgcatttgattatggaagta
agttctcaagcttacttgaaacaacgtgtttacggtctacgttataatgttggcgcgttt
ttaaatatttcgccggatcacatcggaccaaatgaacacccaacttttgaagattatctg
gctcataaaatgatgctgtttgatcattcagaccaggttattgtgaatgctgaaagtgag
catcttaagacagttttggggcatgcgacgcaaacacacgataaggtttatacgtacagt
ttggcgggtcaaggtggcaattattcttatgtttcacgagaaagcgctattcacgaaagt
cgactaattgttgagccaagtgatttaaatgaacttgctggtgaatatcgtttgaattta
ccaggtgactttaatgagtcaaacgctatggcagcattaattatgactgcactggctggc
gcaaaacacgaaaatatggttcatggattagatgttgtttttatacccggtcgcatgtta
agcttgccaattgtaggtcatggcgttgcctttgtagactatgctcataattatgcatcg
atgcgtgcattacttaattttgctcaaaaccagtatccagaaggtaaagtattggttgtt
gttggatctcctggcaataaaggggtctcgcgacgtgctgactttggccgagtagtttcg
gaactagcagatattgtctatttaacagctgacgatccccaatttgaatcgccaaaagct
attgccgatgaaattgctgaaaatattaataataaacagcttgaggttcattttgaaatg
gatcgtatcaaggcgatttttcaagcaattaagcaatcaggagagagagacattgtcata
gttgccggtaaaggtgaagacccctaccaaaaaattaatggtaaggatgtaccatatatt
ggtgattatgcagttgttcaaagttaccatgactaa

DBGET integrated database retrieval system