KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_0868Help
Entry
LEGAS_0868        CDS       T01267                                 

Gene name
pyrB
Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00240  Pyrimidine metabolism
lgs00250  Alanine, aspartate and glutamate metabolism
lgs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LEGAS_0868 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LEGAS_0868 (pyrB)
Enzymes [BR:lgs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LEGAS_0868 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CBL91516
Position
886253..887164
Genome map
AA seq 303 aa AA seqDB search
MRHFLNINSVNESDVLKLIQRALAFKSGVQPDQTNLTVSNLFFENSTRTHSSFQMAENKL
GFQQIRIEPQSSSMSKGESLVDTLKTLKAIGVDVAVIRHNVTSWYESVLSAEGHAIPQLV
NAGDGSGQHPSQSLLDLVTIYEQFGHFTGLNIRIVGDLMHSRVARSNAEILKRLGANMTF
SGPENWLPKDFSQFGEFVAIDKEWEQLDVVMFLRVQHERITQTENQIFLTKQYHAKFGLN
KLRYEQLKAQAIIMHPAPVNRDVEIADEFVEAPKSRIFEQMTNGVFARMAILEYTMETNH
ATY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcgacattttttgaatataaattcagtaaatgaatctgatgtgctaaaattaattcaa
cgggccttagcattcaagtcaggtgtgcagcccgatcagaccaatttgacggtaagtaat
ttgttttttgaaaattctacacgtacgcatagcagttttcagatggcagaaaataagtta
ggttttcaacaaattagaattgagccgcaaagcagttcaatgtcaaaaggtgaaagttta
gtcgacacgttgaaaacactaaaagctattggtgttgatgttgctgttattaggcataat
gttacgagttggtatgaaagtgttctgagtgcagaaggacatgctataccacagcttgtg
aatgctggggacggcagtgggcagcatccttctcagagtttgctagatttggtgacaatt
tacgaacaatttggtcattttactggtttaaatattcgaattgttggtgatttaatgcat
tctcgtgtggcacgttcaaatgcggaaattttgaaaagattaggcgctaacatgacattt
tctggaccagaaaattggctaccaaaagattttagtcaatttggtgagtttgtggctatt
gataaagaatgggaacagcttgatgttgtgatgtttctgcgtgtgcaacatgagcgtatc
acacagactgaaaatcaaatttttttaaccaaacaatatcatgctaaatttggactgaat
aaattacggtatgaacagcttaaagcgcaggcaattatcatgcatccagcaccagttaat
cgtgacgtggaaattgccgatgaatttgttgaagcaccaaagtcacgtatttttgaacaa
atgacgaatggggtgtttgcaaggatggcaatactagaatatacaatggagacaaatcat
gcaacttattaa

DBGET integrated database retrieval system