KEGG   Leuconostoc gasicomitatum: LEGAS_1017Help
Entry
LEGAS_1017        CDS       T01267                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lgs00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lgs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1037081..1037560)
Genome map
AA seq 159 aa AA seqDB search
MSENVYQFTVMKENGETYSLDELRGRPIIIVNTATKCGFAPQFSELEAIYQKYKDDGLMI
LGFPSNQFKQELNSSHDAAEACRLSYGVTFPMHHLIAVNGKNTDPLFKYLKKSIPGPLGS
TIKWNFTKFLVNRDGQVVKRFAPKTSPNDMIDDIKNVLK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaatgtatatcaatttactgtcatgaaggaaaacggggagacttattcactt
gatgaactgcgagggcggccaataattatcgttaatacggctactaagtgtggctttgca
ccacagttttcagagcttgaagccatttatcaaaaatataaagatgatgggttaatgata
cttgggtttccatcaaatcagtttaaacaagaattgaattctagtcatgatgcagcagaa
gcatgtcgactttcttatggcgttacatttccaatgcatcatttaattgcagttaatggt
aaaaatacagatcctttgttcaaatatttgaaaaaaagtataccgggtccattaggaagt
acgatcaaatggaatttcaccaaatttttggttaatcgtgatggacaagtagtgaaacgt
tttgcaccaaaaacgagtccaaacgatatgattgatgatatcaaaaacgtgttaaaataa

DBGET integrated database retrieval system