KEGG   Leuconostoc gasicomitatum: LEGAS_1091Help
Entry
LEGAS_1091        CDS       T01267                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LEGAS_1091 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEGAS_1091 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LEGAS_1091 (thrC)
Enzymes [BR:lgs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LEGAS_1091 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1111356..1112819)
Genome map
AA seq 487 aa AA seqDB search
MMKYVSTRGQAPAVTASQAILNGISPDGGLYVPEKWPEISLDWSVLKTQTYSDLATLIFD
AFFDDFSVSEIDYIIKKAYGKQWETDNVVSFHEENDLTYIELFHGPTLAFKDVALQALPH
LMTTAAKKQAMSDKIVILTATSGDTGTAAMSGFGDVSQTEIIVFYPEEGVSEIQRQQMQT
ETADNAHVIAITGNFDDAQKAVKTLLADESLAKDLKAEGLRFSSANSINIGRLVPQIVYY
IYAYAQLIKDEKIKAGDEINIVVPTGNFGNVLAAYYASQIGLPVKQFIVASNENNVLTDF
FTTGKYDSNRHFKVTNAPAMDILVSSNLERLLYFASGQNSDEIQAYMTALQEDGAYVIKP
DTRANLNKFVAAFATQDQVSETIKKIANATNYTIDPHTAVGRYAYEQTAVTGPTLIAATA
SPYKFSETVLQALNMAPVSGQAALAQLSKMTGTEIPIQIATLFNKPIRHKQVIDSKQILA
TLKHEIF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatacgtttccacacgtggtcaagcaccggcagtaacagcaagtcaagctatt
ttgaatggtatttcaccagatggcgggttatatgtaccagaaaagtggcctgaaatatca
cttgactggtcggtcttaaaaacgcaaacttattccgatttggcaacattaatatttgat
gccttttttgatgattttagtgtctctgaaatcgattacattattaagaaagcttatggt
aagcaatgggaaactgacaatgtggtatcattccacgaagaaaacgatttaacatacatt
gagttatttcatggtccaacccttgcctttaaagacgttgctctacaggcactaccacat
ttaatgactactgctgcaaaaaagcaggctatgagtgataagattgttattctcacggcc
acatcaggagacacaggcacagctgctatgagtggctttggggatgtttctcagacagaa
ataattgttttttatccagaagaaggtgtcagtgagattcaaaggcaacaaatgcaaaca
gaaacggctgataatgcgcatgtcattgcaattactggtaattttgatgacgctcaaaag
gcagttaagaccttacttgctgatgaatcattagcaaaagatttaaaggcagaaggtctg
cgattttcatctgcaaattcgataaatattggacgccttgtcccacaaattgtttattat
atatatgcttatgctcaactgattaaagacgaaaaaattaaagctggagatgaaattaac
attgtggtgccaacaggtaactttggcaatgttttggcagcttactatgcgagtcaaatt
ggattacccgtgaaacagttcattgtcgcttcaaacgaaaacaatgtgttaacggatttc
tttacaacaggtaaatacgatagtaaccgtcatttcaaagtgacaaacgcaccggccatg
gatatcttggtatctagtaatttagaacgtttattatattttgctagtggtcaaaatagt
gatgaaattcaggcatatatgacagcattacaggaagatggggcctatgttatcaaacct
gatacacgtgccaacttaaacaaatttgttgctgcgtttgcaacacaagatcaagtatct
gaaacaattaaaaagattgccaacgcgacaaactatacaattgatcctcatacagccgtt
ggtcgttatgcttatgaacaaacggctgtgacaggaccaacgttgattgccgcaacagca
agtccttacaagttttcagaaactgtattacaggcacttaatatggcgccggtgtccgga
caagccgcacttgctcaattatcaaaaatgacaggaactgaaattcctattcaaattgca
acattatttaataaaccaatacgacataaacaggtgatagattcaaaacaaattttagct
accctcaagcatgaaattttttaa

DBGET integrated database retrieval system