KEGG   Leuconostoc gasicomitatum: LEGAS_1181Help
Entry
LEGAS_1181        CDS       T01267                                 

Gene name
rbsK2
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LEGAS_1181 (rbsK2)
Enzymes [BR:lgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LEGAS_1181 (rbsK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1210881..1211792)
Genome map
AA seq 303 aa AA seqDB search
MTKNIVVLGSLNVDNIMKMPRMPLVGETMALTDVTTAPGGKGANQAVAAARQGANVSFIG
SVGNDSNGQFMRATLLSNGVNVNAVTTNSEVPTGSAYIMLQENGANTILIHGGANQALTV
ADLDENVIAKADTLIAQFEVPLEVIVAAFKIAKANNVQTILNPAPAVYDLIPELTHVTDI
ILPNETEAQLLTGITVENNEAVLNRVSNAILAKGVPRSIITLGDAGSFVADRDKRWWVKP
NKVDAVDTTGAGDTFIGTLASVIDADFNNLEETVKRASIASAIAVTRAGAIPSIPTRDEV
DAF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaatattgttgtacttggtagcctaaatgtcgataacattatgaaaatgcca
cgcatgccactagtcggtgaaactatggcattaactgatgtgacgacagcacccggtggt
aagggagcaaaccaagcggtggccgccgcacgtcaaggagccaatgtctcatttattggt
tctgttgggaatgatagcaatggtcaatttatgcgtgccacattactttcaaatggggtt
aacgtcaatgcagtgacaacaaatagtgaagtacctactggatcagcttacattatgttg
caagaaaatggggcaaatacaattttgattcatggtggtgcaaatcaggcactcacagtc
gctgatttagatgaaaatgtgattgcaaaagcggatacactgattgcacaatttgaggta
ccattagaggttattgttgcagcttttaaaattgctaaggcaaataatgtgcaaactatt
ttaaaccctgcaccagctgtttatgatttaataccagaattaacgcatgtaacagatatt
attttaccaaatgaaactgaggcacaattattgacgggtattaccgttgagaataatgaa
gcagttttgaatcgtgtgagcaatgcaattctagctaaaggtgtgccacgtagtattatt
acattaggtgacgcgggttcttttgtagcggatagagataagcgttggtgggttaaacct
aataaagttgatgcagttgatacaacaggtgctggtgatacttttattggtacgttagcc
agtgtgattgatgctgattttaataacttggaagaaactgtgaaacgggcaagtattgcg
agtgcgattgctgtcacacgtgctggcgctattccttcaatcccgacacgtgatgaggtc
gatgctttctaa

DBGET integrated database retrieval system