KEGG   Leuconostoc gasicomitatum: LEGAS_1319Help
Entry
LEGAS_1319        CDS       T01267                                 

Gene name
gpmA1
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEGAS_1319 (gpmA1)
   01230 Biosynthesis of amino acids
    LEGAS_1319 (gpmA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_1319 (gpmA1)
  Energy metabolism
   00680 Methane metabolism
    LEGAS_1319 (gpmA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEGAS_1319 (gpmA1)
Enzymes [BR:lgs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LEGAS_1319 (gpmA1)
Exosome [BR:lgs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LEGAS_1319 (gpmA1)
  Exosomal proteins of melanoma cells
   LEGAS_1319 (gpmA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1359593..1360267)
Genome map
AA seq 224 aa AA seqDB search
MVAQLVLVRHGESTANRDNEFTGWTDVPLTLKGQQQAKRVGEILVQKQLLFDKVHTSYLQ
RAITTANIVLFEMNQSWVPINKTWRLNERHYGALRGLNKDMARSKYGVEAVALWRRSYTD
VPPLLEKVVSDRRYPNSIEPLGESLEMASQRMLPYWLEVVVPELRAGHNQLIVAHGSTLR
ALIKYLEKISDNDIDGLEIGNGEPICYTFDEKFNMSERQYLESN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggttgcacaacttgtattggttcggcacggcgaatcgacagctaatcgagataatgaa
tttactggttggaccgatgtacctttaaccttaaaaggtcagcagcaagccaagcgtgtc
ggtgaaattttagtacaaaaacagttactttttgataaggtacatacatcctatttacaa
cgtgcgattacaacagccaatattgttttgtttgaaatgaatcagtcttgggtaccaatt
aataaaacatggcgattaaatgaacgtcattatggtgcactacgtgggttaaataaagat
atggcgcgatcaaaatatggtgttgaagcagttgccttatggcgccgtagctatacagat
gtgccgccactgttggaaaaagtggtatcagaccgacgttatcctaatagtattgaacca
cttggtgagagcttagaaatggcaagtcaacggatgctaccttactggctagaagttgtg
gtgcctgaattacgcgctggccataatcaattgattgtggctcatggtagtacattacgc
gcattaataaaatatttagaaaaaattagcgacaatgatattgatggtttggagattggt
aatggcgagccaatctgctatacgttcgacgaaaaatttaatatgagtgagcgccaatac
ttagaatcaaattaa

DBGET integrated database retrieval system