KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_1319Help
Entry
LEGAS_1319        CDS       T01267                                 

Gene name
gpmA1
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00010  Glycolysis / Gluconeogenesis
lgs00260  Glycine, serine and threonine metabolism
lgs00680  Methane metabolism
lgs01100  Metabolic pathways
lgs01110  Biosynthesis of secondary metabolites
lgs01120  Microbial metabolism in diverse environments
lgs01130  Biosynthesis of antibiotics
lgs01200  Carbon metabolism
lgs01230  Biosynthesis of amino acids
Module
lgs_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_1319 (gpmA1)
  Energy metabolism
   00680 Methane metabolism
    LEGAS_1319 (gpmA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEGAS_1319 (gpmA1)
Enzymes [BR:lgs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LEGAS_1319 (gpmA1)
Membrane trafficking [BR:lgs04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LEGAS_1319 (gpmA1)
Exosome [BR:lgs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LEGAS_1319 (gpmA1)
  Exosomal proteins of melanoma cells
   LEGAS_1319 (gpmA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBL91967
Position
complement(1359593..1360267)
Genome map
AA seq 224 aa AA seqDB search
MVAQLVLVRHGESTANRDNEFTGWTDVPLTLKGQQQAKRVGEILVQKQLLFDKVHTSYLQ
RAITTANIVLFEMNQSWVPINKTWRLNERHYGALRGLNKDMARSKYGVEAVALWRRSYTD
VPPLLEKVVSDRRYPNSIEPLGESLEMASQRMLPYWLEVVVPELRAGHNQLIVAHGSTLR
ALIKYLEKISDNDIDGLEIGNGEPICYTFDEKFNMSERQYLESN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggttgcacaacttgtattggttcggcacggcgaatcgacagctaatcgagataatgaa
tttactggttggaccgatgtacctttaaccttaaaaggtcagcagcaagccaagcgtgtc
ggtgaaattttagtacaaaaacagttactttttgataaggtacatacatcctatttacaa
cgtgcgattacaacagccaatattgttttgtttgaaatgaatcagtcttgggtaccaatt
aataaaacatggcgattaaatgaacgtcattatggtgcactacgtgggttaaataaagat
atggcgcgatcaaaatatggtgttgaagcagttgccttatggcgccgtagctatacagat
gtgccgccactgttggaaaaagtggtatcagaccgacgttatcctaatagtattgaacca
cttggtgagagcttagaaatggcaagtcaacggatgctaccttactggctagaagttgtg
gtgcctgaattacgcgctggccataatcaattgattgtggctcatggtagtacattacgc
gcattaataaaatatttagaaaaaattagcgacaatgatattgatggtttggagattggt
aatggcgagccaatctgctatacgttcgacgaaaaatttaatatgagtgagcgccaatac
ttagaatcaaattaa

DBGET integrated database retrieval system