KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_1379Help
Entry
LEGAS_1379        CDS       T01267                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00010  Glycolysis / Gluconeogenesis
lgs00020  Citrate cycle (TCA cycle)
lgs00620  Pyruvate metabolism
lgs01100  Metabolic pathways
lgs01110  Biosynthesis of secondary metabolites
lgs01120  Microbial metabolism in diverse environments
lgs01130  Biosynthesis of antibiotics
lgs01200  Carbon metabolism
Module
lgs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_1379 (pdhC)
   00020 Citrate cycle (TCA cycle)
    LEGAS_1379 (pdhC)
   00620 Pyruvate metabolism
    LEGAS_1379 (pdhC)
Enzymes [BR:lgs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LEGAS_1379 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: CBL92027
Position
complement(1428426..1429733)
Genome map
AA seq 435 aa AA seqDB search
MTEIFKMPDIGEGMAEGDITSWLIKVGDVVAMDDPVAEVQNDKLIQEILSPYAGKVTKLF
VEAGTTVEVGDSLIEFDGDGSGEAASGQEPDKVDKKQVSEVPLKNPTVPTETVTSPQTES
IVHVANGHVLAMPSVRHLAYEKGIDLTKIMPSGRHGHVTLSDVEKFQDVGETTPEINAQQ
VVKTTEALSTNNSSSLAAPEPLREGRQPLTAVRRAIAKAMTTQNANIPSVTNFDSVEVSK
LVAHRQIFKTQAANDGIHLTYLAYVVKALAATAKKFPELNASLDMATQEVIYHDDVNMGV
AVSTASGLYVPVIGHADQKSILTIASEISELAEAVRTGTIRPQQMQGGTITISNLGSARG
TWFTPIINGKEVAILGLGSILKEPIVNENDDLTIGQNMKLSLSYDHRLIDGMLGQSAMNY
LKQLLTDPAYMLMEV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaaaatgcctgatattggtgaaggcatggctgagggagatattaca
tcatggctcattaaggtcggagatgtagtggctatggatgaccctgttgctgaagttcaa
aatgataaattaattcaagaaattttatcaccttacgctggtaaagtgacgaaattattt
gtcgaagcaggtacaactgttgaagttggtgattcattaattgaatttgatggtgatggc
agtggtgaagctgcaagtggtcaagaaccggataaggtggataagaagcaagtttctgaa
gtaccattaaaaaatcctactgtaccaactgaaacagtgacgagtccgcaaacagaaagc
atcgtacacgttgctaatggtcatgttttagctatgccttcagttcgtcatttggcttat
gaaaaaggaattgatcttacaaaaattatgcctagtggtcgtcatggacacgttactttg
tctgatgttgaaaaattccaagatgttggtgaaacaacaccggagattaatgcacaacaa
gtagttaaaacaacagaagcgcttagcacgaataatagttcttctctggctgcacctgaa
ccattacgagagggtcgtcaaccattaacagcagtacgtagggcaattgctaaagcaatg
actacacaaaatgccaatattccatcggttactaattttgattcagttgaggttagtaag
ttagtggctcatcgtcaaatatttaaaacgcaagccgctaatgatggcattcacttgaca
tatttagcatatgttgtgaaagcattagctgccacagcaaaaaaattcccagaattgaat
gctagtttagatatggcaacacaagaagtcatctaccatgatgatgttaatatgggtgta
gcagttagcacagcatcaggattgtatgtaccagtgattggacatgcggatcaaaagtca
attttgaccattgcttcagagatttctgaacttgctgaagcagttcgtactggaaccatt
cgccctcagcaaatgcaaggtgggacgattacgatttctaatttaggatcagcacggggc
acatggttcaccccaattattaatggtaaagaagtcgctatcttggggctgggttcaatt
ttgaaagaacctattgtcaatgaaaatgacgatcttacaattggtcaaaatatgaagcta
tcactgagctatgatcatcgtctaattgatggcatgcttgggcaatcagctatgaactat
ttgaagcaattattgaccgatccggcttatatgttaatggaggtgtaa

DBGET integrated database retrieval system