KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_1390Help
Entry
LEGAS_1390        CDS       T01267                                 

Gene name
gmk1
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00230  Purine metabolism
lgs01100  Metabolic pathways
Module
lgs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LEGAS_1390 (gmk1)
Enzymes [BR:lgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LEGAS_1390 (gmk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA AAA_33 MMR_HSR1 AAA_16 AAA_22 cwf21 Rad17 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CBL92038
Position
complement(1441862..1442461)
Genome map
AA seq 199 aa AA seqDB search
MMTQRGLLIVLSGPSGVGKGTVRKAIFEEDGIDFQYSISATTRQPRIGEVNGEDYFFVSR
EAFEEKISNGDMLEYAQYVNNYYGTPKSFIDETLASGRDVFLEIDVQGALQVKSKMPEGV
YIFLTPPDLTNLRERLVGRGTDSQEVIEKRVTAARDELKQMINYDYAVENDQVVFAVERI
KSIITAERLRVARVFEKTL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatgacacagcggggtttattaattgtgctatctggcccatccggcgttggtaagggt
acagtgcgcaaagctatttttgaagaagatggcattgattttcaatactctatttcagct
acaactcgtcaaccaagaattggcgaagtgaacggcgaagattatttctttgtatcgcgt
gaggcatttgaagaaaagatttcgaatggtgacatgctggaatatgcacagtatgttaac
aattactacggtaccccaaaaagtttcattgacgaaacgctagcaagtgggcgtgacgtt
tttcttgagattgatgtccaaggtgcattgcaggtgaaatcaaaaatgcctgagggagtt
tatatttttttaacgccgcctgacttgactaatttgcgcgaaaggcttgttggtcgtggc
actgattcacaagaggtcattgaaaaacgtgtaacagccgcacgcgatgaattgaaacaa
atgattaattacgattatgctgtagaaaatgatcaagttgtgtttgccgttgagcgaatt
aaatcaattattacagctgaacggttacgtgttgcacgtgtttttgaaaaaacattataa

DBGET integrated database retrieval system