KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_1539Help
Entry
LEGAS_1539        CDS       T01267                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00330  Arginine and proline metabolism
lgs00332  Carbapenem biosynthesis
lgs01100  Metabolic pathways
lgs01130  Biosynthesis of antibiotics
lgs01230  Biosynthesis of amino acids
Module
lgs_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LEGAS_1539 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LEGAS_1539 (proB)
Enzymes [BR:lgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LEGAS_1539 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase DRE2_N
Motif
Other DBs
NCBI-ProteinID: CBL92187
Position
complement(1583359..1584174)
Genome map
AA seq 271 aa AA seqDB search
MQVVSEKSSAANDWRRIVIKVGTSTIVDASGEIKYPVINRLSQTLTQLQKSGYDIILVTS
GAIGVALQQMKMVKRPTDIPAQQALAAIGQSYLMAIYNQSFAFYQQHVGQVLLTYDVFNN
KQMLQHTIDAIEAMLAQHVIPIINENDVIAVDELDHQHSFGDNDRLAAIVTHETNADGLI
VLSDIDALYTDNPYVNPTAKKIPLVTQVTPELMASASGSSDLGTGGMATKLYAAEYLISK
QRQMILINGKNPATILDVVAGKKMGTLFKGV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtagtgtcagaaaaaagtagtgctgccaatgattggcgccgtatagtgattaag
gtcggtactagcacgattgttgatgcatcaggtgagattaaatatccagtgattaatcgt
ttgtcacaaacactgacacaattacaaaaatcaggatatgacattattcttgttacttca
ggggcgattggtgtcgcgttgcaacagatgaaaatggtgaaaagaccaacagatataccg
gcgcaacaagcattggcagctattggtcaaagttatttgatggctatctataatcaaagt
tttgctttctatcaacagcatgttggacaagtattattaacttatgatgtttttaataat
aagcagatgctacagcatacaattgacgcgattgaagctatgctagcacaacatgtgatt
ccaattattaacgaaaatgatgttattgccgttgacgagttagatcatcaacattcattt
ggtgataatgatcgcttagcagctattgtcacacatgaaacaaacgctgatggtctcatt
gtattaagtgatatcgacgcgttatatactgacaacccttatgtcaatccaactgctaaa
aaaataccacttgtcacgcaagtaacgccagaattaatggctagtgctagtggctcatca
gatttaggaaccggtggcatggcgacaaaactttatgctgctgaatatttgatttcaaag
caacgccaaatgatattaattaatggtaaaaatcctgctacgattttagatgttgtagct
ggcaaaaaaatgggtactttatttaaaggagtgtaa

DBGET integrated database retrieval system