KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_1662Help
Entry
LEGAS_1662        CDS       T01267                                 

Gene name
gmk2
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00230  Purine metabolism
lgs01100  Metabolic pathways
Module
lgs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LEGAS_1662 (gmk2)
Enzymes [BR:lgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LEGAS_1662 (gmk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_23 AAA_33 ABC_tran AAA_28 MMR_HSR1 AAA_14 AAA_24 AAA_16 dNK RsgA_GTPase NTPase_1 CoaE AAA_5 T2SSE AAA_30 Zeta_toxin AAA AAA_29 PRO8NT Sigma54_activ_2 Sigma54_activat
Motif
Other DBs
NCBI-ProteinID: CBL92310
Position
complement(1692709..1693293)
Genome map
AA seq 194 aa AA seqDB search
MKDNKVFVITGATGVGKTTIARYLQDNYRMPRVITHTTRAPRDREINGISYYFEDDITFE
TKHYLERVKYAGSQYGSSYEALECAWQKSPYITIVLDTAGAITYARELGKQAVIIFVTVT
SPEVLVERVQVRGDDPTAVKQRVASPEFLRDVLLPTELKNVAYELANDDWSKTKVRLDLL
VNDIMNGRSLPQKN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacaataaagtatttgtaattacgggtgcaactggagtaggtaaaacaacaatt
gcgcgatatttacaagataattatcgtatgccacgtgttattacacacacaacaagagca
ccacgggatagagaaattaatgggatatcatactatttcgaagatgatatcacatttgaa
acgaaacactacttagagcgagtaaaatacgcaggatcacaatatggttcatcttatgag
gcacttgaatgtgcttggcaaaaaagtccgtatattacaattgtattggacactgctggc
gcaataacttatgctcgtgaacttgggaaacaggcagtgatcatttttgttacggtcacc
agccctgaagtattagttgagcgtgttcaagtgcgtggtgatgatccaacggctgttaag
caacgtgttgcttcaccagagtttttgcgtgatgtcttgttaccgactgaattaaaaaat
gtcgcttatgaattagctaatgatgattggtcaaagacaaaggtcaggcttgacttactt
gtaaatgacattatgaatgggcgtagtttgcctcaaaaaaattag

DBGET integrated database retrieval system