KEGG   Leuconostoc gasicomitatum: LEGAS_1685Help
Entry
LEGAS_1685        CDS       T01267                                 

Gene name
gpmA2
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lgs  Leuconostoc gasicomitatum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lgs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEGAS_1685 (gpmA2)
   01230 Biosynthesis of amino acids
    LEGAS_1685 (gpmA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEGAS_1685 (gpmA2)
  Energy metabolism
   00680 Methane metabolism
    LEGAS_1685 (gpmA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEGAS_1685 (gpmA2)
Enzymes [BR:lgs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LEGAS_1685 (gpmA2)
Exosome [BR:lgs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LEGAS_1685 (gpmA2)
  Exosomal proteins of melanoma cells
   LEGAS_1685 (gpmA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1719937..1720650
Genome map
AA seq 237 aa AA seqDB search
MAKLVLIRHGQSEWNALNLFNGWVDTKLSDKGVTQAKEAGELLATEGIQFDQAYTSVLTR
AITTLHFALEEAGQLFIPETKSWRLNERHYGALQGQNKAEAAEKWGDEQVHIWRRSYDVL
PPLLDSYEETVEVQGTTYPAFDRRYADVPKGELPLGENLKITLERVLPFWESDISKDLKA
GKNVVIAAHGNSLRALAKHLEHISDDDILNLEIANGQPLVYDLDNNLEVISKKTLSK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttagtattaatccgtcacggtcaaagtgaatggaacgcattaaatttgttc
aacggttgggttgacacgaagttatcagataaaggtgttactcaagctaaagaagctggc
gaattattggctactgaaggtatccaattcgatcaggcttatacatcagttttaacacgt
gccattacaacattgcactttgcattagaagaggctggacaattgttcatccctgaaacc
aaatcatggcgtttgaatgaacgtcattatggcgccttacaaggccaaaacaaagctgag
gctgccgaaaaatggggtgacgagcaagttcacatctggcgtcgttcatatgacgtatta
ccaccattgttggacagctatgaagaaactgttgaagtgcaaggaacaacttaccccgct
tttgatcgtcgttatgctgatgtaccaaaaggtgaattacctttaggtgaaaacttgaag
attactttggaacgtgtgttacccttctgggaatcagacatttcaaaagatttgaaagct
ggtaaaaacgttgttattgctgctcacggtaattcattacgtgccttagcaaaacatctt
gagcatatttcggatgacgacatcttaaatctcgaaattgctaatggacaacccttagta
tacgatttggataataatttggaagttatctctaagaaaacattaagtaagtaa

DBGET integrated database retrieval system