KEGG   Lactococcus garvieae Lg2: LCGL_0291Help
Entry
LCGL_0291         CDS       T01963                                 

Definition
phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lgv00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294724..296226
Genome map
AA seq 500 aa AA seqDB search
MTLRKDFLWGGAVAAHQLEGGWNVGGKGVSVADVMTAGANGVERRITDGVLPGENYPNHE
AIDFYHRYKEDVKLFAELGVNCFRTSIAWTRIFPNGDEREPNEEGLQFYDDLFDECLKNG
IEPVITLSHFEMPYHLVTEYGGWRNRRLIDFFVRFAEVVMTRYKDKVKYWMTFNEINNQA
NFDMDFAPFTNSGLKFVEGENREKIMYQAAHYELVASAKVVDLGHKINPDFEIGCMIAMC
PIYPATCKPEDMMAAQVAMQRRLWFTDVHARGHYPSYMLKYFERKAFDLDITPEDIEDLS
KGEVDYIGFSYYMSFAIKDQAEKLDPSLKLNYMPSTAEKMENQENLGAPTFDYIENRDLV
KNQYVKASEWGWQIDPLGLRYSMNWFNERYEKPLFIVENGFGAVDKVEEDGRIHDPYRVE
YLKAHIEAMKDAVEYDGVDLMGYTPWGFIDLVSAGTGEMKKRYGFIYVDKDNEGNGSLER
SKKDSFEWYSQVIASNGEKL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactttaagaaaagatttcctatggggcggtgctgttgctgctcaccaacttgaaggt
ggctggaatgtaggaggcaaaggggtttctgtggccgatgttatgactgctggagcaaac
ggagttgagcgccgaattacagatggtgtcttacccggtgaaaattatcctaaccatgaa
gccattgacttctaccatcgctataaagaggatgtcaaactttttgcagagttaggtgta
aactgtttccgtacgtccattgcttggactcgtatttttcctaatggagatgaacgtgag
cctaatgaagaagggcttcaattttacgatgatttgtttgatgaatgtttgaaaaacggg
attgagcccgtcatcacgctttcacattttgaaatgccttatcatttggttaccgagtat
ggtggctggcgtaatcgccgtttgattgacttttttgtaagatttgctgaagtagtcatg
acccgctataaagataaagttaaatactggatgacatttaatgaaataaataatcaggca
aattttgatatggattttgcaccatttacgaactctgggttgaagtttgtagagggtgag
aaccgtgaaaagattatgtatcaagcggcacactatgaattagttgcttctgctaaagtt
gtggatctcggacataaaattaaccctgatttcgaaattggttgcatgattgcgatgtgt
cctatttatcctgcaacatgtaaacctgaagatatgatggcagcacaggttgccatgcaa
cgtcgtttatggtttaccgatgtacatgcgcgtggacattacccaagctatatgcttaaa
tattttgaacgcaaggcttttgatttagatattactccagaagatattgaagatttatcc
aaaggagaagtagattatatcggctttagttattatatgagttttgctattaaagatcag
gcggaaaagcttgatccaagtcttaagctcaattatatgccaagtacagcggaaaaaatg
gaaaatcaagaaaatctgggagcgccaacttttgattatattgaaaaccgagatttggta
aaaaatcaatatgtcaaagcatcagaatgggggtggcaaattgacccactaggtctgcgt
tatagcatgaactggttcaatgagcgttatgaaaaaccactttttattgtagaaaatggt
tttggtgctgtggataaagtcgaagaagatgggcgcattcatgatccataccgtgtggaa
tatctgaaagcacacattgaagcaatgaaagatgctgtagaatacgatggcgtagatctg
atgggctacacaccatggggctttattgatctcgtttctgcagggactggagagatgaaa
aaacgctacggttttatctatgtagataaagacaatgaaggaaatggcagcttggaacgc
tcgaagaaagattcatttgagtggtacagtcaagttattgcatcgaacggagagaaatta
taa

DBGET integrated database retrieval system