KEGG   Lactococcus garvieae Lg2: LCGL_0291Help
Entry
LCGL_0291         CDS       T01963                                 

Definition
(GenBank) phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
lgv00010  Glycolysis / Gluconeogenesis
lgv00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCGL_0291
   00500 Starch and sucrose metabolism
    LCGL_0291
Enzymes [BR:lgv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LCGL_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4028
Motif
Other DBs
NCBI-ProteinID: BAK59751
UniProt: F9VBQ0
Position
294724..296226
Genome map
AA seq 500 aa AA seqDB search
MTLRKDFLWGGAVAAHQLEGGWNVGGKGVSVADVMTAGANGVERRITDGVLPGENYPNHE
AIDFYHRYKEDVKLFAELGVNCFRTSIAWTRIFPNGDEREPNEEGLQFYDDLFDECLKNG
IEPVITLSHFEMPYHLVTEYGGWRNRRLIDFFVRFAEVVMTRYKDKVKYWMTFNEINNQA
NFDMDFAPFTNSGLKFVEGENREKIMYQAAHYELVASAKVVDLGHKINPDFEIGCMIAMC
PIYPATCKPEDMMAAQVAMQRRLWFTDVHARGHYPSYMLKYFERKAFDLDITPEDIEDLS
KGEVDYIGFSYYMSFAIKDQAEKLDPSLKLNYMPSTAEKMENQENLGAPTFDYIENRDLV
KNQYVKASEWGWQIDPLGLRYSMNWFNERYEKPLFIVENGFGAVDKVEEDGRIHDPYRVE
YLKAHIEAMKDAVEYDGVDLMGYTPWGFIDLVSAGTGEMKKRYGFIYVDKDNEGNGSLER
SKKDSFEWYSQVIASNGEKL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactttaagaaaagatttcctatggggcggtgctgttgctgctcaccaacttgaaggt
ggctggaatgtaggaggcaaaggggtttctgtggccgatgttatgactgctggagcaaac
ggagttgagcgccgaattacagatggtgtcttacccggtgaaaattatcctaaccatgaa
gccattgacttctaccatcgctataaagaggatgtcaaactttttgcagagttaggtgta
aactgtttccgtacgtccattgcttggactcgtatttttcctaatggagatgaacgtgag
cctaatgaagaagggcttcaattttacgatgatttgtttgatgaatgtttgaaaaacggg
attgagcccgtcatcacgctttcacattttgaaatgccttatcatttggttaccgagtat
ggtggctggcgtaatcgccgtttgattgacttttttgtaagatttgctgaagtagtcatg
acccgctataaagataaagttaaatactggatgacatttaatgaaataaataatcaggca
aattttgatatggattttgcaccatttacgaactctgggttgaagtttgtagagggtgag
aaccgtgaaaagattatgtatcaagcggcacactatgaattagttgcttctgctaaagtt
gtggatctcggacataaaattaaccctgatttcgaaattggttgcatgattgcgatgtgt
cctatttatcctgcaacatgtaaacctgaagatatgatggcagcacaggttgccatgcaa
cgtcgtttatggtttaccgatgtacatgcgcgtggacattacccaagctatatgcttaaa
tattttgaacgcaaggcttttgatttagatattactccagaagatattgaagatttatcc
aaaggagaagtagattatatcggctttagttattatatgagttttgctattaaagatcag
gcggaaaagcttgatccaagtcttaagctcaattatatgccaagtacagcggaaaaaatg
gaaaatcaagaaaatctgggagcgccaacttttgattatattgaaaaccgagatttggta
aaaaatcaatatgtcaaagcatcagaatgggggtggcaaattgacccactaggtctgcgt
tatagcatgaactggttcaatgagcgttatgaaaaaccactttttattgtagaaaatggt
tttggtgctgtggataaagtcgaagaagatgggcgcattcatgatccataccgtgtggaa
tatctgaaagcacacattgaagcaatgaaagatgctgtagaatacgatggcgtagatctg
atgggctacacaccatggggctttattgatctcgtttctgcagggactggagagatgaaa
aaacgctacggttttatctatgtagataaagacaatgaaggaaatggcagcttggaacgc
tcgaagaaagattcatttgagtggtacagtcaagttattgcatcgaacggagagaaatta
taa

DBGET integrated database retrieval system