KEGG   Lactococcus garvieae Lg2: LCGL_0338Help
Entry
LCGL_0338         CDS       T01963                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LCGL_0338
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LCGL_0338
Enzymes [BR:lgv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LCGL_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344510..345793
Genome map
AA seq 427 aa AA seqDB search
MDKIIVKGGNTRLKGTVEIEGAKNAVLPLLAATLLPSEGEIILRNVPILSDVYMMNNLVD
HLGVDLEFSEESKTVHAQAAAKVKTKAPYEFVSKMRASIVVMGPILARNGHARVSMPGGC
SIGSRPIDLHLRGFELMGAEITQEAGYIEAKAEKLRGAHIYLDFPSVGATQNLMMAATLA
EGTTTLENAAREPEIVDLANWLNKMGANVKGAGTDTIIIKGVEKMHGANHAVVQDRIEAG
TFMVAAAMTQGDVLIKDAVREHNRPLISKLIEMGVEFVQEEEGLRVLGPETLKATNVKTL
PHPGFPTDMQSQMTAAQAIAKGESTMIETVFENRFQHLEEMRRMGLTVDITRNTAIIQGT
RKLQGAQVKSTDLRASAALILLGMVAQGQTTVRKLSHLDRGYYRFHEKLKSLGADIERVP
ELEEIDD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggataaaataattgtcaagggtggaaatacccgccttaaaggaactgtagaaattgaa
ggagcaaaaaatgctgttctgcctttgcttgcagcgacacttttgccaagcgagggagaa
attattcttcgtaatgttcctattttgagcgatgtttacatgatgaacaatttagtggat
catcttggggtggatttagagttttcagaagaaagcaagacagttcatgcacaagcagct
gctaaagtaaaaacaaaagcaccctacgaatttgtaagcaaaatgcgtgcctctatcgtt
gtaatgggaccaattttggctcgtaatgggcatgctcgtgtctcaatgcccggaggttgc
tcaattgggtcacgtcctattgatctccacttacgtggctttgaattaatgggtgcagaa
attactcaagaagcgggttacattgaagctaaggctgaaaagcttcgtggcgcacacatc
tatttggacttcccatctgtaggggccacacaaaacttgatgatggctgcaactctagcc
gaaggaacaacaactttagaaaatgcagcacgcgagcctgaaattgttgaccttgccaac
tggctcaataaaatgggagcaaatgttaaaggtgctggtacagatacaattattatcaaa
ggtgttgaaaaaatgcatggtgctaaccatgcagtcgtacaagaccgtatcgaagctgga
actttcatggtagcagcggcaatgacccaaggcgacgtcttaattaaagatgcggttcgt
gaacacaatcgtcccttaatttctaaattaatcgagatgggtgtagagtttgtacaagaa
gaagaaggcctgcgtgttcttggccctgaaaccttaaaagcaacaaatgtaaaaacatta
ccacatcctggcttcccaacagacatgcaatcgcaaatgactgcggctcaagctatcgct
aagggcgagtccacaatgattgagacggttttcgaaaatcgtttccaacatttagaagaa
atgcgtcgtatgggtttaaccgttgatattacacgtaacacagccatcatccaaggcaca
cgaaaactacaaggcgcacaagttaaatcaacagatttacgtgcaagtgccgcattaatt
ttacttggtatggttgcgcaaggtcaaactacagtacgtaaattgagtcaccttgatcgt
ggttattaccgattccatgaaaaattaaaatcacttggagcagatattgaacgtgttcca
gaacttgaggaaattgatgattaa

DBGET integrated database retrieval system