KEGG   Lactococcus garvieae Lg2: LCGL_0474Help
Entry
LCGL_0474         CDS       T01963                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LCGL_0474
Enzymes [BR:lgv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LCGL_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
487644..490082
Genome map
AA seq 812 aa AA seqDB search
MTEKIYFTGTIEAIFFSNPSNFYKVLLLEVDDTNSAYEDYEIVVTGTIGELIEGDSYTFY
GKLTTHPKYGEQLQVETYEKAVPTSAAGLIKYFSSDKFPGIGKKTAERIVALFPDDTVDS
ILSKPEELDSILPLAKRNSFIKRLRDNHGVEKILSKLAEYGIPSKLQFQIHELYKDQTLD
IIAKNPYQLVEDIKGIGFKTADQIAQELGIAADSSDRFRAGLMHVVKTQPLITGDTYIEA
RDLLQQTIQLLEEARQIEVSPETVAEEINHLLEDGKMQQEETKIFENSLYFAEQGISEYL
KKLIGRSTQTFSDEKILKNIEQVETKLGIRYDKLQKEAIFQALNSQFFILTGGPGTGKTT
IINGFIETYAQLHDIDLDPGHYHDDVFPILLAAPTGRASRRMNELTGLPAATLHRHLGLN
TDEAMDMESNDLAGSLLIVDEFSMVDTWLANKLLQAIPPSMKVLFVGDADQLPSVGSGQV
FADLLKLPEIPSVRLDKIFRQGAESTIIDLAHEIKEGHLPQDFTSRHPDRSYFEAGPGQV
APLVTQVATAWKKRGNNPFELQILAPMYKGVAGINTLNGLLQELFNPLDERQEFNYQDIH
FREEDKVLHLVNDAENNVFNGDLGRIVELIPAKHTESKQDEIVMDFDGQEVSYPRAEWYK
ITLAYAMSIHKSQGSEFSTVVVPMVSSYSRMLERNLLYTAITRAKQSLILIGEQKAFAQA
VQKESANRKTFLKERFTGKSEPGEKLKHTLDADNETTGQVSPPRTEEISLFPEENVTSTS
YATEPFLTADLVNSGDFDPLIGLTAADFAIFK
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaatatattttaccggaacaattgaagcgattttctttagtaaccctagt
aatttttataaagtacttttactagaagtggatgacaccaatagcgcttatgaagattac
gaaattgttgtaaccggaacaattggggagctgatagaaggagacagttatactttctat
ggtaagcttacgacacatcccaaatatggggagcagcttcaagttgaaacttatgaaaaa
gctgtgccgaccagtgctgctggactaatcaaatacttttcttctgataaatttccgggt
attggtaaaaagacggcagaaagaattgtggctctttttcccgacgataccgttgacagt
atcttaagtaagccggaagaactggacagtattcttcctttagcaaagagaaattccttt
atcaaaagactacgtgacaatcacggtgtggaaaagattttatcaaagcttgcggaatat
ggtattcccagtaagctccaatttcaaattcatgagctttacaaagatcaaaccttggat
attatcgccaagaatccataccagttggttgaagatatcaaaggcatcggctttaaaaca
gccgaccaaattgctcaagagttaggaattgcagccgatagtagtgaccgttttagagcg
ggactgatgcatgtggttaaaacacagcctttaattacgggcgacacctatattgaagcg
cgtgatcttttgcagcaaaccatccagctcttggaagaagcgcgtcagatagaagttagc
ccagaaactgtggctgaagaaatcaaccatctgcttgaagatggtaagatgcaacaagaa
gagactaaaatatttgaaaattccctttattttgctgagcaaggcattagtgaatacctc
aaaaaacttattggacgcagtactcagaccttctcagatgagaaaatcttgaaaaatatt
gaacaagtagaaaccaagctaggtattcgctacgataaactgcagaaagaagctattttt
caagctttaaatagtcagttcttcattttaacgggtggaccaggaacaggtaaaaccacg
attatcaacggttttatcgaaacttatgcacaacttcatgacattgatttagatcctggg
cattatcatgatgatgttttccccattctgctggcagcaccaacaggaagagcgagtcgc
cggatgaatgaacttaccggcttaccagcagcaacgctccatcgtcatttaggtttaaat
actgatgaagcaatggatatggaaagtaatgatcttgcgggttcacttttgattgtagat
gaattttcaatggtagatacctggttggccaataaacttttacaagccattcctccttcc
atgaaggtgctctttgtaggtgatgcggatcagctgccatcagttggttctgggcaagtc
tttgcagacttgctgaagcttccagagattccttcagttcgcttagataaaattttccgt
caaggcgctgaatcaacgattattgatcttgcccatgaaatcaaggaaggacatttgcca
caagactttaccagtcgtcatcccgatcgttcttattttgaagctggaccgggacaagtt
gctcctcttgtgacacaagtggcaaccgcgtggaaaaaaagaggaaataatcctttcgaa
ttgcagattttagcaccgatgtataaaggtgtagctggtataaataccttaaatggctta
ttgcaagaattgttcaatccgcttgatgagcgacaagagtttaactatcaggatattcat
tttcgtgaggaggacaaagttctccatttggtcaatgatgcagaaaacaatgttttcaat
ggtgacttaggaagaattgttgaactcattccagcaaaacatacagaaagcaaacaagac
gaaattgtgatggattttgatggtcaagaagtgagctatcctcgcgcagaatggtataaa
atcactttggcttacgcgatgtctattcacaagtcacaggggagtgagttttcaacagtt
gtggttccaatggtttcttcctattcaaggatgttggaacgtaatctcttgtatacagct
attacgcgagccaaacaaagtctaattcttattggagaacaaaaagcctttgcccaagct
gtgcaaaaggaaagtgccaatcgaaaaactttcttgaaagagcgatttacagggaaatca
gagcctggcgaaaaactaaagcatactttggatgcggacaacgaaacaaccgggcaagtg
agtcccccgcgaacagaggaaatttcgctttttcctgaagaaaatgttacgtcgacatcc
tatgcgacggagccttttttaacagcggatttggttaattctggtgattttgatccattg
attgggcttacggcagctgattttgcgatttttaaataa

DBGET integrated database retrieval system